CAZyme Information: MGYG000001522_01118

Basic Information

• Species: Pauljensenia radingae_A
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia radingae_A
• CAZyme ID: MGYG000001522_01118
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	MGYG000001522_5|CGC2	71601.03	6.8987

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001522	2458350	Isolate	not provided	not provided

• Gene Location: Start: 181560; End: 183497 Strand: -

Full Sequence      

MRPWARCPENPPTSPKMSAMTAPRIAAVVVAWNRAELLRETLGALAQQSRPLDDIIVVDN
ASTDDTPQAIQGSEAVTDTVTLPSNFGGAGGFAAGIARAVSRGADFVWIMDDDTVPHVDA
LERLLEARAEYPGEPAVMACRAEWFDGREHPMNKPRRRAFLRPVLHQHAEAADSYQIRTA
SFVAILLDVRAIREDGLPEAAYFLWNDDFEYTARLLRRRVGLYVDAARVEHRTKTFGNST
ASPGARFVNEVRNKMWAFGRSQAFGPIERCAFMAMTTMRWVRLLATSPDRTQLWNYLKEG
VEQANEEPSSTADVLSDTPVACEAAQLDRRASRQGQNGTSDLCERIQQEQADTFVAEGAA
SDETLPFSVLLPVYIKDDPAHFQRALQSVGADQSLAANEIVIVCDGPVSPKIDEILDSAR
HGRSPHLVADIPVKVIRLERNRGLSAALNAGLQHCSYDIVARADADDISVPERFARQLPV
MEQGFDIVGAAIVEFSVDENGTGMIRRQPTHQHDIVSAFTFHDPFNHPAVVYRASAVKEV
GGYQHLDLMEDYWLFARMVASGARVTNLSDVLVKYRVGAGAYQRRGGLRLLKSEVELQRR
LRSHGITTRGQLVRNLAIRATYRIVPTGLRRAGYRLWRQLSQPQA

Enzyme Prediction     

No EC number prediction in MGYG000001522_01118.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	27	193	4.3e-22	0.9705882352941176
GT2	368	510	6.2e-20	0.8117647058823529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	4.13e-85	368	576	1	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04185	GT_2_like_b	2.29e-42	27	256	1	201	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.36e-22	23	267	3	258	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	9.10e-18	368	507	1	130	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.02e-15	27	146	1	125	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT98587.1	0.0	1	645	1	645
QPK80727.1	3.14e-223	20	634	1	597
ANC32836.1	5.19e-186	20	634	1	604
ABS05353.1	5.33e-184	8	635	9	616
QNN53639.1	5.12e-161	24	635	4	595

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46635	5.72e-47	367	599	2	225	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2
Q48215	7.75e-45	365	629	1	256	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
Q03084	2.24e-41	361	630	2	263	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase OS=Escherichia coli OX=562 GN=wbbD PE=1 SV=1
P9WMX3	9.61e-15	27	298	7	287	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
P9WMX2	9.61e-15	27	298	7	287	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001522_01118.