CAZyme Information: MGYG000001516_01763

Basic Information

• Species: Limosilactobacillus antri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus antri
• CAZyme ID: MGYG000001516_01763
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000001516_45|CGC2	44247.07	4.794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001516	2241837	Isolate	not provided	not provided

• Gene Location: Start: 83434; End: 84600 Strand: -

Full Sequence      

MNEKIKGVNLGGWLVLEKWMSPHLFDGTAADDEYYLAQDLPAAVYQARISQHRANFITEE
DFLRIASLGFNLVRLPVPYFVFGDRAPFIGAIAEVDRAFNWAEAYGIKILLDLHTAPDSQ
NGFDNGGISGVCKWASEPAEVEFEKSVVKRLAERYGKRPGLYGIEVLNEPATAAMFSDMQ
RRFPPRDPAKAAGSAPISFDFLYQYYRDCYDLLRPLLPADKVIMFHDGFDIDKWEDFFKQ
SDFANVVLDTHQYLMMAEMKNHDLSLAAYEKTMTDFGKKIAAVNQYVPVVTGEWSLFNSY
TAGVDTNGGINPTQQEFGGATHLSKEELRHAYQTLWKTQVDAWNQGIGYIYWTYKLNIDT
INEPAWYGWDCWALQRVVDKKWLAPQDI

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	355	1e-137	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	6.04e-30	3	382	16	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	2.20e-07	56	170	24	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMS07884.1	5.55e-290	1	388	1	388
AJT51054.1	1.35e-217	3	388	4	389
AGV73077.1	2.96e-187	1	387	1	389
AEU40475.1	8.45e-187	1	387	1	389
ARE23414.1	1.70e-186	1	387	1	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.71e-150	4	383	2	386	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.21e-149	4	383	2	386	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	7.07e-41	1	355	9	372	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	3.86e-35	2	366	6	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	7.41e-35	2	366	6	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WK60	3.67e-48	2	366	39	391	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
B0XN12	5.13e-48	2	366	39	391	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q0CR35	1.40e-47	3	370	38	392	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
Q5B5X8	8.22e-47	3	366	27	379	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
A1D4Q5	1.04e-46	2	366	39	391	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001516_01763.