CAZyme Information: MGYG000001514_01084

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_01084
• CAZy Family: SLH
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
979	MGYG000001514_11|CGC1	102815.76	4.5065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 12894; End: 15833 Strand: -

Full Sequence      

MKQLRRKSNKFLGLILGLSLLVSSAAGALTAPAQANAETNAKGSSLQQHWAGAVLKEWKD
KGFIKGDEQGNLQPDAKVTRAQLAALVNRSFQLEESKAVSYSDVKAEAWYYKEVAKAAAK
GYMKGYENGTFKPNADVSRQELAVILTSLLGLKPSDAFHSFKDTANSPAWSKGAIGAVTD
NGIMKGSNGSFNPLAPATRAEVVSVLDRALKQTSGQAIVTYDKAGSYGSSAGTETIKGSV
HIKAADITLNNLLIEGDLLLGEGIGEGDVTLNNVTVKGSTIVEGGGKNSIHVVDSVLLTV
IVNKKDGSVRIVAEGGSVVSQVTLQSGAILEEAGLSGLGFQDLILSEQIPAGAEISLAGK
FETVDVVATSLNINLASGSIGELSIGDQAAGNNIQIGASALISSLILNAATNVGGQGSIG
HAVINASGSTLAQRPGSTSYISNNSVHINGQLSSGGTGITSGSSSSGSGGNSGNNGGSTQ
PEDSHLIVTNGKISLKFMSAVPGLELADLNVTATIAGEAVSLENMAFNSAANELSFDPVS
LEEHYGKPLAVQVTPNEGVSKFSGILSGSAYLTGFAGSIVDVDDQPVEGMTIKFRRGLAN
TSGAVAATVVTDQNGRYLVNLPAGIYTGELNKAGFIKGYVVGVSVSDQFNRNEDATAIKV
PESGELRIVLTWGERPLDEDSHLIGPTPAGGNFHTWYGDKVHYFNGEVYADLDHDDVDSY
GPETTTIRQRVDGLYTFYVHNYSRNGYDGRETLRKSSAKVEVYDASGTPMATYHIPVGEG
NELYWHVFDMKIEGSSIEFIDQNILMNDAPSGTVSDPNAEYALLLEEQNKLASVTTVTYD
AQLDEALSLTYPGQSLLDDTEVQILSLFPSSVTDDVYLTKSPDQSKVILSQYNNTGDSVF
YSAEVELTRGGFKVTSWLEIELPTMDVLLIEAKAVAEALGRPELASEIQAVNDALGAGVD
HSVKIAALQSLLDALANLQ

Enzyme Prediction     

No EC number prediction in MGYG000001514_01084.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM54	221	328	1.3e-28	0.9035087719298246
SLH	101	141	7.8e-18	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033190	inl_like_NEAT_1	5.35e-15	49	212	589	754	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam00395	SLH	1.02e-11	101	142	1	42	S-layer homology domain.
COG4676	YfaP	5.21e-08	654	759	133	227	Uncharacterized conserved protein YfaP, DUF2135 family [Function unknown].
pfam00395	SLH	1.72e-07	161	202	1	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	2.89e-07	86	211	567	692	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWP25495.1	0.0	10	978	10	1105
AVV56260.1	0.0	10	978	10	1105
ANA79717.1	0.0	10	978	10	1105
ANF98139.1	8.02e-223	44	979	39	993
QMV42120.1	6.85e-218	16	975	16	973

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GZT_B	3.01e-21	289	452	1	167	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_A	5.75e-16	205	288	25	108	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6BT4_A	2.49e-10	49	212	33	198	Crystalstructure of the SLH domain of Sap from Bacillus anthracis in complex with a pyruvylated SCWP unit [Bacillus anthracis]
3PYW_A	2.54e-10	49	212	12	177	Thestructure of the SLH domain from B. anthracis surface array protein at 1.8A [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38537	2.57e-19	21	211	19	207	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
C6CRV0	9.79e-18	50	211	1291	1460	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
Q06852	1.11e-09	61	212	2101	2266	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
P49051	1.29e-08	49	217	41	211	S-layer protein sap OS=Bacillus anthracis OX=1392 GN=sap PE=1 SV=1
P19424	3.09e-08	50	232	49	236	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000456	0.998719	0.000194	0.000269	0.000170	0.000152

TMHMM  Annotations     

start	end
12	34