CAZyme Information: MGYG000001514_00691

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_00691
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000001514_10|CGC1	39698.54	4.6744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 132545; End: 133606 Strand: -

Full Sequence      

MARKWSYVAAAAAIISIAGVFWFCRQGDDEQKPRTVTGEPELELSAWVVDWNWESGVADL
QHISRKLERLQVFAAYFDSENHLYFTDDMYEALPRIFETARQGGVQDVDLTIVNDRWNPD
GTSVQKDPEVVTRILGSQESQEKHIAEIIDIVERYGFDGVEMDFEKVSEADWEKLSSFYE
ELYERLNAKGKALRIILEPRTPIERLSLPEGPVYVMMAYNLFGSHSGPGPKADHSFIQKL
ASRMKALPGETAIALSVGGFDWADGGKAASVTEQRAAELLQLSSATSPVRDKASGSLHFT
YKDEDGRKHTVWYADGETIAQWVGVAEQSGYHNIVLWRLGEFEQATLNRLKGL

Enzyme Prediction     

No EC number prediction in MGYG000001514_00691.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	131	341	1.5e-19	0.706081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06549	GH18_trifunctional	3.62e-43	110	340	63	291	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02874	GH18_CFLE_spore_hydrolase	1.91e-42	52	344	11	308	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.77e-25	110	344	164	413	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd00598	GH18_chitinase-like	2.44e-05	73	221	31	161	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
smart00636	Glyco_18	5.34e-05	132	228	83	193	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK46436.1	2.09e-187	1	353	1	353
AJS61569.1	2.28e-139	4	350	7	351
BBI33133.1	1.02e-124	8	350	16	359
ATF16294.1	2.45e-124	15	347	18	349
ANY71977.1	9.91e-124	3	351	5	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.38e-12	129	339	84	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	3.17e-10	60	340	122	411	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	9.89e-08	129	347	185	421	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
5JH8_A	9.62e-07	137	345	85	305	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	1.59e-12	129	339	176	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	1.69e-10	127	340	102	329	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P0DPJ9	9.70e-10	60	340	121	410	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.72e-08	60	340	121	410	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996925	0.002728	0.000306	0.000017	0.000009	0.000035

TMHMM  Annotations     

start	end
5	24