CAZyme Information: MGYG000001512_02253

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_02253
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	MGYG000001512_19|CGC4	34424.44	7.9408

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 265831; End: 266694 Strand: +

Full Sequence      

MVRIVEIIGGLGNQMFQYAFFLYLKNKSHIWDRLYVDIEAMKTYDRHYGLELEKVFNLSL
CPISNRLHRNLQKRSFAKHFVKSLYEHSECEFDEPVYRGLRPYRYYRGYWQNEGYFVDIE
PMIREAFQFNVNILSEKTKAIASKMRRELSVSIHVRRGDYENLPEAKAMHGGICSLDYYH
KAIDFIRQRLDNNICFYLFSDDINWVEENLQLENRCIIDWNQGEDSWQDMYLMSCCRHHI
IANSSFSWWAAWLNPNKNKIVLTPNKWFNHTDAVGIVPKSWIKIPVF

Enzyme Prediction     

No EC number prediction in MGYG000001512_02253.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	4	284	3e-77	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	2.82e-67	4	272	3	260	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.69e-28	5	265	4	277	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	0.003	119	253	137	280	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63862.1	1.38e-223	1	287	1	287
SNX52916.1	1.32e-80	4	284	3	287
QRQ49131.1	7.11e-79	2	286	1	280
QUT44870.1	7.11e-79	2	286	1	280
QQY37044.1	3.72e-76	2	286	1	280

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	1.11e-29	9	284	7	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866D2	2.55e-09	115	253	173	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Leontocebus fuscicollis OX=9487 GN=FUT1 PE=3 SV=1
Q866E8	2.56e-09	115	253	174	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
Q866F0	2.56e-09	115	253	174	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1
Q866F1	2.56e-09	115	253	174	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri sciureus OX=9521 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_02253.