CAZyme Information: MGYG000001512_00270

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_00270
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		41764.13	5.6042

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 25096; End: 26223 Strand: -

Full Sequence      

MKNTEKFLSRIHCHRPILYFLAILFFFTTNSCSSAPVISPENAIIPETPEDTNTPEIKTP
GDGSITDKNILYVGRWDKSDNTVFHSYWTGAYLRVNFTGKSIGIKLRSNTSLVVSIDGET
PRAVVGQSGITLLNTTTLSEGTHTLLVGSAGQNYEVEFEGLVLDKNAVTYPPDKKLLIEY
IGDSITAFGGSDNTPTVNYAWQTAELLGCDHTQISFSGLSLSSGYGCLDTKIGMDSLYFN
LKNYNHIHERPVIPWNFSYTPDIVFIFLGTNDECGQAPEEVVSLNSRNMIYKIRQKFNDA
EIFVMRPFKGIYENALSSAVRRLNSMGDEKIHFIDTTGWLSESDFSDGTHPNETGTSKII
NKLVPTLKPFVKNNF

Enzyme Prediction     

No EC number prediction in MGYG000001512_00270.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	178	365	4.6e-30	0.9808612440191388

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	2.12e-15	178	368	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	3.78e-13	72	167	1	102	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam13472	Lipase_GDSL_2	1.62e-12	181	355	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01828	sialate_O-acetylesterase_like2	1.97e-10	261	368	49	169	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd01833	XynB_like	3.64e-10	252	367	32	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI62554.1	3.99e-281	1	375	1	375
AHF11716.1	4.51e-131	57	374	20	337
AQQ75129.1	4.30e-65	53	367	32	349
ACU62289.1	3.32e-64	61	373	45	357
AEV97647.1	8.74e-63	63	371	52	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XVH_A	5.32e-13	69	352	1	308	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002107	0.199576	0.797880	0.000135	0.000158	0.000123

TMHMM  Annotations     

start	end
17	39