CAZyme Information: MGYG000001508_01295

Basic Information

• Species: Thalassobacillus devorans
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Halobacillaceae; Thalassobacillus; Thalassobacillus devorans
• CAZyme ID: MGYG000001508_01295
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001508_5|CGC3	43038.33	4.6002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001508	4066265	Isolate	not provided	not provided

• Gene Location: Start: 395562; End: 396683 Strand: -

Full Sequence      

MVSTNKELTEQLTTPLEWGKAACDSLMAAYDASELPPDGRWHYHQGVFLESMRQLKEVIG
GNEEYEQYIKAYVDHNIDENGNFLWNRKELDAIQAGLLLFELDRTTDDKRYKIAATKLKN
MFPTLNRTSDGGFWHKDRYPYQMWLDGLYMGGVFAMNYAKAYDESELLDMVLEQERLMRK
HTLDKNTGLYHHAWDESKKQPWADPETGKSPEFWGRAIGWYGITYNEILDFLPDGHSLEE
ELAGALRDLAASLVKYQDSETGLWYQVVDRLDEKDNWIETSCSALFIYTIARGIRGGYVD
ESYKEHAIKGYRGLLERMEFDENGLFTMPEICIGTGVGDYEHYINRPKTANDLHGVGSFV
LASIEMQHLLPEL

Enzyme Prediction     

No EC number prediction in MGYG000001508_01295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	37	367	7.2e-104	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.15e-118	14	370	7	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.55e-113	18	370	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAS52176.1	1.64e-231	1	373	1	373
QHA38001.1	2.56e-223	11	373	10	371
QTN01429.1	6.51e-220	27	373	1	346
AYB43535.1	2.06e-161	6	366	6	365
ACX66348.1	2.76e-159	6	366	6	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	1.50e-141	14	369	12	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.11e-141	14	369	2	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	1.18e-73	17	369	3	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.30e-17	127	370	183	414	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	3.28e-16	127	350	147	361	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	8.23e-141	14	369	12	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.85e-31	150	365	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.85e-31	150	365	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001508_01295.