CAZyme Information: MGYG000001507_03797

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_03797
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619	MGYG000001507_1|CGC54	71470.83	6.0652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 3930006; End: 3931865 Strand: -

Full Sequence      

MRELKGKHVVLHDNDLKRREEANRGYLMKLTNDNLLFNYKVEAGRYDGRDIPQDAHGGWE
TPVCQIRGHFLGHWLSAAAMRFHETGDLELKLKADLILDELAECQKDNGGQWAAPIPEKY
LHWVAQGKAIWAPQYNIHKLFMGLVDMYQFTGSQKALEIADRFADWFVEWSSTFTREKFD
DILDMETGGMLEAWADLLQITGNAKYTTLLERYYRSRLFRPLLENKDPLTNMHANTTIPE
VLGCARAYEVTGEQRWMDIVTAYWKCAVTERGTLATGGNTAGEVWMPKMKIKARLGDKNQ
EHCTVYNMIRLAEFLFRHTSHPAYAQYIEYNLYNGIMAQAYYQEYHLTGNKHNNPATGLL
TYFLPMKAGLRKDWSTETDSFFCCHGTMVQANAALNRGIYYQNQNDVYVCQYFNSELNTE
LGGESVRIQQSQDYMSGSMLNSSNTAGHQELNEITALHENLPDYKKYDFVVHTGSAQAFA
IHLRIPDWIMSEAVIYVNDQLHGKSTDHNAFYSIMRNWKDGDRISIILPVGIRFIPLPDD
ELTGAFRYGPEVLAGICENERILFTQDDIASELIMENEREWGSWRYFFKTANQDPGIQLR
RIRDIGYEPYQVYFTVKKA

Enzyme Prediction     

No EC number prediction in MGYG000001507_03797.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	9	554	2.1e-171	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	7.64e-112	8	554	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.84e-72	5	566	8	513	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ41686.1	0.0	1	619	1	620
AIQ30072.1	0.0	1	619	1	620
QUL52142.1	0.0	1	619	1	620
AIQ58795.1	0.0	1	619	1	620
AIQ68968.1	0.0	1	619	1	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	8.68e-60	9	554	33	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.30e-55	9	554	33	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
5MQO_A	6.93e-08	135	532	192	581	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	6.07e-07	38	535	57	537	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.17e-06	38	535	57	537	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_03797.