CAZyme Information: MGYG000001507_03648

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_03648
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000001507_1|CGC49	34889.08	4.5933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 3777644; End: 3778597 Strand: -

Full Sequence      

MLVGKEAFCDYQTIAEAVDVLEQLPAGEAQTLYILAGVYEENVRIYRSDLTITGIGEVMI
RSNRYARQLDEAGEEQGTFATPTLFLGGSRLIVENLIVVNTAGQGPDIGQALALYAHCDE
TVFRNCTFKGHQDTIFTGPLPAANKHGGPFGGIPLRERHEICRQLYTGCYIEGTVDFIFG
GAAAYFEHCEIRSLKSTNEGSGFITAASTPQGQSYGYVFDECYLTAGEGVSGVYLGRPWR
GYARTEFMNCRLGSHIHPAGWDNWGNPANETTVCYREYGIADDDKLREQRVPWALLSGEG
EAVPSKALVFEGTEFWK

Enzyme Prediction     

No EC number prediction in MGYG000001507_03648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	295	7.1e-77	0.9236111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.55e-53	10	289	93	383	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.56e-51	3	294	4	275	Pectinesterase.
PLN02773	PLN02773	6.14e-49	10	301	16	288	pectinesterase
PLN02708	PLN02708	1.44e-43	3	294	245	526	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	1.73e-41	10	309	22	286	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ48433.1	3.06e-185	1	316	1	316
AIQ53921.1	1.19e-182	1	317	1	317
AIQ19701.1	1.60e-181	1	317	1	317
AIQ59861.1	6.77e-168	1	316	1	316
AIQ31089.1	1.15e-167	1	316	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.84e-34	2	293	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	2.70e-31	11	288	19	272	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.42e-30	11	288	19	272	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.53e-29	1	293	9	281	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	1.37e-19	3	279	7	308	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.82e-40	3	294	9	279	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O81320	2.88e-37	1	294	165	437	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1
O49298	2.90e-37	1	293	251	516	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
O04887	3.36e-37	1	293	203	472	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1
Q8L7Q7	1.49e-35	4	294	296	575	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_03648.