CAZyme Information: MGYG000001507_03064

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_03064
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000001507_1|CGC44	43725.48	4.889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 3221653; End: 3222810 Strand: -

Full Sequence      

MGKQWAVRTAESIMERLPRLYQDKGYNGKWSYDYGVVLKGFELLWKQTGDRKYFDYIADN
MNYFIQEDGDICGYRQDEYNIDHINNGKLLFTLYAETGLEKYRLAADSLREQLRTHPRTS
EGAFWHKSIYPYQIWLDGLYMGSPFYLQYLLAFEAGQGMEDVTKQFILCEKHTKDPATGL
LFHAWDEQMVQPWCDPETGLSANFWGRSMGWYLMALVDVLELLPEDHADYAELVRILRNT
LTALEKFQDAEAGVWYQVVDLGERKGNYLEASASSMIVYAIGKGIRLGILGAGWNAVLDR
AYAGLITEFVLETKEGWVNLNKNCRVAGLGGADKRDGTYAYYISEPIITNDQKGVGAFLQ
ACAEYEHLRAGQLAAEKGGSHAAGI

Enzyme Prediction     

No EC number prediction in MGYG000001507_03064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	24	366	1.4e-114	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.64e-117	30	368	34	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.70e-106	5	366	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ53380.1	5.51e-243	10	383	2	375
AIQ34932.1	9.79e-227	5	369	6	370
AWV32855.1	6.58e-225	4	369	5	370
AIQ73516.1	9.35e-225	4	369	5	370
AIQ23081.1	3.11e-223	5	369	6	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.62e-148	30	368	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	6.30e-89	29	368	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.62e-88	29	368	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	4.13e-18	19	306	56	330	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.01e-17	19	312	55	335	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.45e-88	29	368	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.79e-39	141	364	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.79e-39	141	364	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_03064.