CAZyme Information: MGYG000001501_01414

Basic Information

• Species: Bacillus_J andreraoultii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; Caldibacillaceae; Bacillus_J; Bacillus_J andreraoultii
• CAZyme ID: MGYG000001501_01414
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1200	MGYG000001501_14|CGC6	139205.63	6.4899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001501	4050118	Isolate	not provided	not provided

• Gene Location: Start: 345860; End: 349462 Strand: +

Full Sequence      

MNKKVLKRRINFIKDPIQNYFVKENHKRVNVYAKYYDQLDIEKNTILYESRDGNSITDSP
YAIFKYLLNNPQFKEYVHIWSVQDFDALDPVISKYKSIPNVKFVKRNSKDYIKYLASCEY
VINNSTFQSFYIHKEGQKYINTWHGTPLKHMGFDIPGSPALSQNVLRNFLSADYILSPNP
HTTKVFTESYKLDGLYEGKIIEAGYPRIDLTLNTNREAFINELYSAGLEIDRQKKNILYA
PTWKGTNVSQANNDVLQIIADMKALEEKVGKDYNILVKVHPFLYKQALQYPELEKKLVPD
YIDPNELQAVVDILITDYSSIFFDFLVTGRPILFYTWDADVYSEERGQYISNEDLPGPIL
YTCKELIEAIQNIDAVEKDYQKNYVNMQKQFTKYEDGKVTERIVNAIFNEQFNDVQVVTC
LNPEKEKILIYPGGLRDNGITSSYINLMNNIDFNRFDVTCFTQAPKSEEILKNMNRVNKN
VRFLFKPGLPAFSLWEIYKDKFVHNRGERGYLGKKLYPEKAYEREQKRLFGNTHFDYAID
FSGYSLYWAKYLLATDAKSKICFMHNDLLSDSERKINGKRPHRINLRGLFSVYHRFDKLV
SVSKGTMELNRKNLIEYADYDKFDYVLNTINPEKILQIHTEDEIENESELNNIETENLKS
NAILVNVKEFPVWNTLPGFLNARKFTLDDTFENAHISVIRMATVNDQLLFKFTYNHQVIG
WIDSRAVELTYDEIISETEVDKLGMVSNVRGHQIWMKPYKMEDNIKVSGAHEYKGIIVSI
DKEIETIHGIYCRINIKGKRIGWIDNRAIKIFNRCTILEDMRSFTKFKINMLRKWLISRN
YGDYRGFINNLENRTLEESTFDEKTFAKIANPGTEKIWTKAYPNYNTKEKAAAVDYQNEI
AEIKKIHKTKAGTYYNFSIAGKISGWLKEEVFEIIDEPILINEKKLLEEAKFITNGPHDV
WDNYFGSGEAKQLHLNGDTVVTVTKEAVSTTGNYLFIELDGKELGWVRKGDLEITDILGL
QVEGQFISYPNKNDLNFVNMGRLSPEKAQGNLIEAFAKFHHDVPNSKLYILGKGPLKDDL
QSLINKLGLNDSVFLMGQLDNPFPFIKRCDCFVLSSHYEGQPMVLLESMTLGMKIVATDI
VANRTVLENGRYGYLVEDSVEGLVEGLEYIANHPNYQPESFDYKTYNEEAMQTFLKALNG

Enzyme Prediction     

No EC number prediction in MGYG000001501_01414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1031	1176	3.2e-32	0.925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	4.47e-95	41	409	2	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.51e-67	31	411	14	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
cd03811	GT4_GT28_WabH-like	2.91e-45	882	1196	37	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	3.57e-34	1029	1175	176	324	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03808	GT4_CapM-like	3.46e-28	1030	1175	185	331	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXN38372.1	0.0	1	1198	1	1200
QNU03158.1	0.0	1	1198	1	1200
ASS97414.1	0.0	1	1198	1	1200
QNK49073.1	0.0	1	1198	1	1200
QYF83788.1	0.0	1	1198	1	1200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	4.13e-52	27	410	332	717	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	3.20e-51	27	410	332	717	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	5.74e-51	27	410	332	717	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
5JQC_A	2.96e-14	672	808	120	258	Crystalstructure putative autolysin from Listeria monocytogenes [Listeria monocytogenes EGD-e]
7EC3_A	6.07e-11	1031	1177	319	467	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC3_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HLM5	2.04e-51	27	410	332	717	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	2.00e-49	43	408	27	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q8RKI5	5.65e-49	46	407	34	392	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
P13485	3.02e-48	17	411	358	746	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q58459	2.11e-23	1032	1139	200	307	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001501_01414.