CAZyme Information: MGYG000001492_01098

Basic Information

• Species: Enterococcus_C massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_C; Enterococcus_C massiliensis
• CAZyme ID: MGYG000001492_01098
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000001492_6|CGC6	42588.35	4.8838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001492	2712841	Isolate	not provided	not provided

• Gene Location: Start: 148621; End: 149721 Strand: +

Full Sequence      

MKLSEVALKTTMERYPSLPEVKRYHGKWSYDFGVVLKGIQAAYQQTKEEKYFNYIQETMD
FFIQEDGSIKNYSYESMNIDYVNNGKLLFLLYQETGAEKYKKALDTLFDQLQHMPRTSEG
GFWHKKIYPYQMWLDGLYMGAPFYAEYLLTFKNGEGMEDVIKQFELCYRHTLDETSGLLY
HAWDEKKEQFWADSKTGVSPNFWGRSMGWFMMALADTMTLLEGEQQAKLQTMFIDCLTAL
QKVQDKQTHTWYQVLDQGARHGNYLEASASSMIVYAAAKALKAGLLEENWRDFVKKSYQG
LVDEFVFYTEEGWINLIRNCEVAGLGGEDKRDGSFVYYISEPIITNDFKGYGAFLQATVV
MEPLNQ

Enzyme Prediction     

No EC number prediction in MGYG000001492_01098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	23	362	2.6e-107	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.54e-96	5	364	13	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.72e-90	9	364	7	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOG31227.1	6.47e-197	4	366	5	368
QGN29886.1	1.85e-196	4	366	5	368
EEV39837.2	5.30e-196	4	366	5	368
ATF73249.1	1.07e-195	4	366	5	368
AMG50372.1	6.16e-195	4	366	5	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.21e-129	28	364	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.45e-79	4	364	17	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.28e-78	4	364	7	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	4.77e-14	28	302	65	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.98e-78	4	364	17	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.14e-33	139	357	1	224	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.14e-33	139	357	1	224	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	5.63e-21	28	303	29	288	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001492_01098.