CAZyme Information: MGYG000001490_01347

Basic Information

• Species: Bifidobacterium catenulatum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium catenulatum
• CAZyme ID: MGYG000001490_01347
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000001490_1|CGC16	45682.66	4.5597

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001490	2079525	Isolate	not provided	not provided

• Gene Location: Start: 1544732; End: 1545940 Strand: -

Full Sequence      

MDLNYIKGVNLGNWLVLEKWMNPALFDGTTADDEYYLPTQLDPAVYEARIRTHRAEYINE
RDFATIKSWGLNSVRIPVPYFIFGDRAPFIGCIDELDKAFNWAEKYGLTILIDLHTAPMS
QNGFDNGGISGVCKWAQLPDEVEFVLSVLERLSKRYGHRRALMGIEIINEPNTTTCWPMA
NVTERYKAVDPELAEGTGPIAFDWLKNFYITAYHRLRDADKGALPTDKVVVFHDGFDIEQ
WKDFMRGPDGKLAPEFKNVVLDTHQYLMTAETMGCPQTAEGYDDFVRNTYAPMIAEMSEY
FPVIVGEWCLFNSVGCGVDTHGGQSVLNGEEGAQVETLTAEQKRSLYRGLAESQLAAWSK
GSGFYYWNYKLLTDTVNTPGWIGWDAWDLGRCIAQNWFPVQK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	52	370	5e-141	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	8.64e-25	5	399	17	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	4.95e-06	56	177	22	139	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR04061.1	0.0	1	402	1	402
BAR02271.1	0.0	1	402	1	402
AZN75184.1	0.0	1	402	1	402
QGM63179.1	0.0	1	402	1	402
BAF39985.1	1.26e-317	1	402	1	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	3.04e-177	6	399	3	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.48e-176	6	399	3	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	9.68e-41	6	399	13	391	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	5.35e-39	2	381	5	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
2PF0_A	1.16e-38	2	381	11	373	ChainA, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RAR6	1.25e-50	6	401	42	405	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
B8N151	4.42e-46	6	401	31	395	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	4.42e-46	6	401	31	395	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q5B5X8	2.34e-45	6	399	29	391	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q875R9	4.70e-45	6	399	48	425	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001490_01347.