CAZyme Information: MGYG000001489_04278

Basic Information

• Species: Parabacteroides goldsteinii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides goldsteinii
• CAZyme ID: MGYG000001489_04278
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776	MGYG000001489_2|CGC26	87399.52	7.7561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001489	6453137	Isolate	not provided	not provided

• Gene Location: Start: 1930685; End: 1933015 Strand: +

Full Sequence      

MLFILFLWGGMYLLVPRTLFPVSYSTLLYSSEGNLLGARIAPDGQWRFPATDSLPDKFIT
CLTTYEDRYFFYHPGIDAAAILRAAYLNVRYHRVVSGGSTLTMQLARLARGNRDRTVYEK
SIEMCWALFLETTHSKKEILNLYASHAPFGGNVVGIETAAWRYFGRSASDLSWAESATLA
VLPNSPALIHPGRNRKQLKTKRDKLLHTLKERNIIDNTEYELSCMEPLPEAPVPLPNEAP
HLLERLAAGTPGIRITSSVQYSLQKQTQELVNRYAREYSSSNHIHNLAALIADVETGEIL
AYAGNATFQADEKRGNQVDIITSPRSTGSILKPFLYAGMLHDGQILPSTLVSDVPLNING
FMPQNYNKTFNGAVPAHRAIERSLNVPLVRMLSQYNTGRFMTLLKTLGMTSLRFSEEHYG
ASLILGGAEGTLWDISGMYASLSRVLTHYRPYNGRYNPQDIHPLTPFPNKEKEPIQSITD
KRLTDKPLLSAASIWFTYEAMSTLNRPEEEADWQQFESMKQIAWKTGTSYGGRDAWAIGT
TPRYVVGVWVGNASGEGRPGLTGVGNAAPVLFDLFSLLPGSSWFDMPYDELEQAVICRNS
GHKASRICDQTDTLYIPRSGINTPVCPYHKLVHLSADGRFRVNSSCESVDRMITRPWFVL
PPSQEYYYRNYHIDYVPLPPIKPGCEQAQSRQIELIYPEHNAILYLPKGFSGKQEKFIFK
AAHARPDATIYWHLDDTYLGETTDNHQIACTVESGKHMLTLIDNWGNQRKILFEVK

Enzyme Prediction     

No EC number prediction in MGYG000001489_04278.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	51	209	9.3e-46	0.8926553672316384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	16	776	2	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	3.48e-163	1	776	12	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	3.35e-123	2	776	14	772	penicillin-binding protein 1C; Provisional
COG0744	MrcB	7.62e-91	4	596	32	615	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	5.84e-85	47	570	2	520	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST53363.1	0.0	8	776	81	848
QRO17107.1	0.0	8	776	81	848
ABR42700.1	0.0	8	776	81	848
QUT95543.1	0.0	8	776	81	848
QKH97196.1	0.0	8	776	81	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	4.87e-30	48	221	22	195	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.67e-29	48	221	22	195	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	3.63e-26	28	551	23	694	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	8.54e-22	28	277	24	253	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
2JE5_A	2.16e-21	22	582	37	637	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	1.94e-92	3	773	19	767	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q9KUC0	1.32e-37	48	570	182	706	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P45345	2.37e-36	55	573	177	699	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1
O66874	2.37e-33	28	551	47	639	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q92G78	2.80e-31	26	576	49	714	Penicillin-binding protein 1A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.941415	0.057812	0.000473	0.000093	0.000068	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001489_04278.