CAZyme Information: MGYG000001489_01636

Basic Information

• Species: Parabacteroides goldsteinii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides goldsteinii
• CAZyme ID: MGYG000001489_01636
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
886	MGYG000001489_1|CGC42	101153.6	5.5452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001489	6453137	Isolate	not provided	not provided

• Gene Location: Start: 2144904; End: 2147564 Strand: +

Full Sequence      

MYKTRLLSTFLLLAGAASAQYQIDLNRITPPTINYLSLGHTGPAGKEIRINNLYLEEGGI
PQLPVMGEIHYNRMDSRYWRDALLKMKASGIDIVATYCIWSLHEEFEGELSWEGHLNLRR
FIELCKELDMKVHLRFGPYCNAEIKNGGLPDWIVNNKNLITRSNDPLYLEYTRRWYQAVY
DQVKGLLWKDGGPVMALQLENEYVRPGMIVSHLLNLKKMAVEIGFDVPLYSMTHWMDSEY
PKGEIVPYAGFYIEAPWTASGKNEIPTSNFEFFTYNRLSDNIGTDIIKIEGDVESLSGEN
NDSPFFTCEIGVGTTAFYQRRAVVPEEMAGENINLRLGCGANMMGYYMYTGGTNPVGKIS
TYQSSGPRISYDYQAPIREFGTLGTVMQETKKYNYFMNDFGTALAPAVAYLPTTNQDRDN
LQWAVRLNGNTGYLFCSNYLYKHSRKDYKNVQFSIKLKDETIRIPRQKVTVKNGTYFLWP
FNQELSNVLLKYSTTQPVCSLKEGNNHTYFFFEDDAIPGEYLIENKDIRNIEVKNGSYRK
EKDRYFINQLTPGKECIIKITKENGSTVRFVTLIEEESDHIWKGTIKGKKFVAITNSSLI
YDNDKITLIDDQPSTEIWTYEDGNFKQQTFQSSAHNLQAEFRPITPMEKSLWIRPTEGNI
AKRQFSLSTFSKVERAYLRYVSSDPISCMINGKETKTTSMDSYSYANVTDFIQNGNNTIE
FNLSNDKEITAEIEVLLKNGKRILWNTDATWLSADNKPVATTTGKNKPSAFAPEEHIGLY
EVKAPAATCGNEETRMYISYKGDVANAYLNGNLIGDSFYDGTEWILSLSRLKESIDTNPM
VIRIDGLKSADVPIYFEKNVVPADCVVPTISDILVKQEYRFELNNQ

Enzyme Prediction     

No EC number prediction in MGYG000001489_01636.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	59	392	3.2e-81	0.9706840390879479

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	4.42e-51	67	394	14	309	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.30e-28	65	455	47	398	beta-galactosidase; Provisional
COG1874	GanA	1.08e-11	67	203	20	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.07e-04	79	203	12	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ34970.1	0.0	1	883	1	883
QCQ48325.1	0.0	1	883	1	883
QCQ52773.1	0.0	1	883	1	883
CBW24573.1	0.0	1	882	1	882
AKA53703.1	0.0	1	882	1	882

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KDV_A	2.52e-30	59	393	29	331	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	3.87e-30	59	393	22	324	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	4.39e-30	59	393	46	348	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	1.03e-29	59	393	46	348	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
4E8C_A	3.33e-27	67	231	22	185	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58D55	5.30e-32	52	393	38	346	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q9TRY9	2.43e-31	51	393	39	348	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q60HF6	8.19e-31	25	393	5	347	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
Q0DGD7	1.83e-30	18	381	4	350	Beta-galactosidase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0539400 PE=2 SV=1
Q93Z24	8.50e-30	67	394	82	397	Beta-galactosidase 17 OS=Arabidopsis thaliana OX=3702 GN=BGAL17 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001014	0.997882	0.000372	0.000238	0.000241	0.000225

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001489_01636.