CAZyme Information: MGYG000001483_02181

Basic Information

• Species: Arachnia massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Arachnia; Arachnia massiliensis
• CAZyme ID: MGYG000001483_02181
• CAZy Family: GT1
• CAZyme Description: O-mycaminosyltylonolide 6-deoxyallosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		43381.49	8.716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001483	3211248	Isolate	not provided	not provided

• Gene Location: Start: 63121; End: 64332 Strand: +

Full Sequence      

MRVVVAAIGSRGDVAPFANLAARFASAGHDVTLITHATLRHLVDPTIPVNEAASDPGELM
ASPAAKAVKRGNIRQLNATRHVFAEFVHSAFEPATEALEDAAVLIASTFAIGAVNEAVRR
GIPVVRAHMWPEYPELDGPMPLLPYGWLAPRPVVRQARAGLRRVEKYLGGVRGWWRRGRL
HLEARHPVGLTTATLGSLYAFSPHLIDEYPADGTVTGWWTDPRRDPALSGPLVEALASGD
DWIFIGFGSMAQDDPQALLRRVGEACAQVRVRAVVQVGDVRGTPHPNLLCVGDEPHDELF
RRVKVAVHHGGAGTTGSAVRAGVPSVVVPHFADQFYWGQRLQALGVAPRPVPRTFASERS
LARSIGAALDPETVSRAAELAARVAPEDGCGRAVRQVETWLGR

Enzyme Prediction     

No EC number prediction in MGYG000001483_02181.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	21	399	6.8e-37	0.9424083769633508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	1.87e-48	1	400	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	3.04e-31	1	403	2	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	4.92e-10	295	403	284	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
PHA03392	egt	1.64e-05	301	381	363	423	ecdysteroid UDP-glucosyltransferase; Provisional
pfam03033	Glyco_transf_28	0.002	3	125	1	115	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFG69960.1	8.47e-192	2	401	23	421
ANS80436.1	5.33e-176	1	401	1	401
QEH92406.1	2.49e-134	1	402	1	402
QQY25238.1	2.02e-133	1	402	1	402
QNK52969.1	5.74e-133	1	402	1	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.67e-28	8	397	27	435	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	4.36e-28	8	397	47	455	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.97e-24	1	395	1	392	CrystalStructure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	3.51e-20	1	384	1	365	ChimericGlycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1PN3_A	4.91e-16	1	377	1	364	CrystalStructure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9XIG1	3.42e-38	1	394	156	567	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
Q9M8Z7	7.67e-38	1	395	193	604	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
A1CFB3	5.28e-35	1	397	908	1321	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1
A1CYS1	2.38e-34	1	397	911	1324	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
Q4WID6	5.84e-34	1	397	902	1315	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001483_02181.