CAZyme Information: MGYG000001476_03359

Basic Information

• Species: Caproiciproducens sp000752215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Caproiciproducens; Caproiciproducens sp000752215
• CAZyme ID: MGYG000001476_03359
• CAZy Family: GH94
• CAZyme Description: Cellobiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	MGYG000001476_17|CGC7	94879.56	5.3457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001476	3737722	Isolate	not provided	not provided

• Gene Location: Start: 857812; End: 860328 Strand: -

Full Sequence      

MMNNREIYGPSGQKWAQFRPDCAGIDLFSLNLPAPWEYIYQNHDVLLKVDQFGPVYAQAN
PPGGIQLFRRENGQKFSSWAVWLQSDELEDRKPFTNFFRPLIDGSDPSKEPPDLKITFLP
HCASYEYRYQDLLVRTEFFVPLHGTEIVMKLRVKNLRKKAMGLSVSPAFVPYVNPAQLAP
WDKYEWYLKSGVGREEKELFWSQLLSSTSDPGERRTAALWTDSEGLCGTEISYEKFVGCG
DLSCPQSVTDGSFRMKPEPPASFGEYRGDNAVWGYPPVYAAKYGCHLEPGGERVFTQVLC
MTQNAADGGLPAVDDVKKSLVYFEAPAYERKKEEARRHFSALCRKNTVRTGQKDWDYFIN
NWLPLQMEWVASLDRGWPTAMRGTRDCAQDYTAMLSIDDTAGRVRLLEMLSCQRSDGWFP
RQFSTEGRTGRHDLRGHVDAGAFVIEFVYEYLSYSGDSGVLDAVLPWLDFDGKNTVLEHL
VRAMEYYIHPENLGEHGLCKIGEGDWLDSVNRAGVLGRGESVMVSEQAVMCLQYMTEILE
NRSGPSATAVVYREKAEEMKKNLLEHAYNQDGFFNGIFTDEGKWIFSDQDPDGEKRPYGP
ANWFALISGVVSEEKRESVLRVMELLKCEAGYRLYWPPMGKIPIRCVGRAASGDAPAGFA
ENGNVYNHGAQGFLARALAAVGNGDALFDVLQWLLPYDQSRHPSNVVLSPPYAIVNCWQE
LPVFRFRSLFSFLTGSVGMAQRAVYEWMFGIRPALDGLVIDPCIPGWMDSASVEFTYRGK
RVKMEIRNPNARSCTPEKVELNGESVFKTQKDPFHFRTVFVLGSELFQDGENTIRVIL

Enzyme Prediction     

No EC number prediction in MGYG000001476_03359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	108	806	4.4e-98	0.640926640926641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	3.74e-50	274	789	507	1020	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.27e-37	338	752	1	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
pfam17389	Bac_rhamnosid6H	4.35e-05	393	704	54	296	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	2.11e-04	406	783	308	639	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMV43990.1	7.50e-234	23	838	23	848
ANS73780.1	1.19e-44	131	787	122	753
QAT16267.1	3.26e-44	251	814	228	798
ACL70723.1	1.57e-43	123	784	106	744
QRT50985.1	3.83e-41	287	789	270	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZLE_A	2.27e-33	311	787	274	747	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
3QDE_A	4.17e-33	138	806	119	790	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
2CQS_A	5.29e-31	132	806	133	827	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3AFJ_A	1.22e-30	132	806	133	827	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
3ACT_A	3.73e-30	132	806	133	827	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7S0S2	1.01e-34	348	806	321	769	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1
B9K7M6	1.31e-32	138	806	120	792	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q9F8X1	2.21e-32	336	813	294	788	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
Q76IQ9	2.30e-28	287	806	254	781	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
P20471	2.23e-18	218	786	2244	2805	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001476_03359.