CAZyme Information: MGYG000001475_00316

Basic Information

• Species: Neobacillus rubiinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus rubiinfantis
• CAZyme ID: MGYG000001475_00316
• CAZy Family: GT14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000001475_11|CGC2	36857.41	8.9811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001475	4309569	Isolate	not provided	not provided

• Gene Location: Start: 67760; End: 68698 Strand: -

Full Sequence      

MGSTPRTAFLLQIHQNPNQVNLFIKQLIAEDQADVFVHIDRKCDPALKKEIISHPNVTIL
QESIECEWGDISQVDVTILLLQEVLATNKLYDFVCLRSGQDLLVNSSFKTFLQCNQGKVF
MTYRLLRRNELGLMKINWLKFARRRYTTLHPFRLFRRLLISLYRKGINLFPNFHQWPSNY
SFYKGSQWFTIPLETARYIINFLNENTWYYQYFTNTLVPDESFFQTLIMNSPYKETVVNN
NLYFLKWGETVSERNSPQILTKHDISNIKKSNQFFARKFDELEDYAVIQYFAETTSLKST
SKLELAEIGVKC

Enzyme Prediction     

No EC number prediction in MGYG000001475_00316.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	8	261	1.1e-44	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02485	Branch	2.71e-14	37	247	31	226	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.
PLN03183	PLN03183	4.34e-10	177	279	248	350	acetylglucosaminyltransferase family protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZU63758.1	7.74e-162	1	309	1	309
QOY34910.1	4.87e-123	1	305	1	308
QWG29159.1	1.70e-111	3	291	27	317
AYF07698.1	4.83e-111	3	291	27	317
QJS18976.1	1.64e-43	6	290	5	279

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJ7_A	7.04e-08	6	299	119	421	HumanXylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG [Homo sapiens],6EJ9_A Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG [Homo sapiens],6EJA_A Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG [Homo sapiens],6EJB_A Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG [Homo sapiens],6EJC_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG [Homo sapiens],6EJD_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG [Homo sapiens],6EJE_A Human Xylosyltransferase 1 in complex with peptide PAAEGSGEQDFT [Homo sapiens],6FOA_A Human Xylosyltransferase 1 apo structure [Homo sapiens]
6EJ8_A	7.05e-08	6	299	123	425	HumanXylosyltransferase 1 in complex with peptide QEEEGSGGGQGG [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5QQ55	1.26e-09	6	290	213	495	Xylosyltransferase OS=Ciona intestinalis OX=7719 GN=xt PE=2 SV=1
Q5QQ53	3.02e-09	6	293	253	542	Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=oxt PE=2 SV=1
Q7KVA1	7.18e-09	6	293	249	538	Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1
Q5QQ50	1.27e-08	2	289	229	516	Xylosyltransferase 2 OS=Canis lupus familiaris OX=9615 GN=XYLT2 PE=2 SV=1
Q9EPI0	1.70e-08	2	289	229	516	Xylosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Xylt2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001475_00316.