CAZyme Information: MGYG000001468_01157

Basic Information

• Species: Blastococcus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Geodermatophilaceae; Blastococcus; Blastococcus massiliensis
• CAZyme ID: MGYG000001468_01157
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000001468_1|CGC7	31931.64	8.7159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001468	3864310	Isolate	not provided	not provided

• Gene Location: Start: 1143312; End: 1144274 Strand: +

Full Sequence      

MDSVASVQARISQIQARFTPVVPTANRGWASAAAAAGLTGTGSASGASATGSAGTASETA
VVAEASKYLGVPYLWGGTDPSKGLDCSGLVQVVFGNLGISLPRTSSQQATSGTAVASLAD
ARPGDLVFFDNSPSRPGIDHVGIYIGNGKMIAAPQAGENVKVQDVGNPTSIRRVLPQAAL
GQTGATSPSGGGGVSGVPYANLFTGAAGRHGVDASLLAAVASVESNFNPGAVSPAGAQGL
MQFMPATARGLGVNALDPASAVDGAARYLKSLTQQFGSTELALAAYNAGPGTVNRYGGIP
PYPETQNYVRSVMSKAEAYR

Enzyme Prediction     

No EC number prediction in MGYG000001468_01157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	214	318	1.1e-34	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	5.51e-42	214	314	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.07e-38	199	320	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	2.07e-35	206	313	11	141	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	9.03e-33	206	308	4	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
pfam00877	NLPC_P60	1.30e-32	70	175	1	101	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG01791.1	5.12e-150	1	320	1	318
ADB73734.1	2.80e-147	1	320	1	318
QXG75046.1	3.43e-126	1	319	1	325
QNG39261.1	6.78e-125	16	319	2	300
CCH86478.1	1.33e-120	7	320	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CFL_A	1.63e-19	61	162	17	117	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
6B8C_A	8.18e-19	61	165	31	131	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
3PBC_A	3.01e-16	61	165	88	199	ChainA, Invasion Protein [Mycobacterium tuberculosis]
3NE0_A	3.01e-16	61	165	88	199	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
4Q4T_A	6.27e-16	61	165	346	457	Structureof the Resuscitation Promoting Factor Interacting protein RipA mutated at E444 [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.34e-30	206	314	67	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	4.51e-28	183	314	1407	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.51e-28	183	314	1407	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P96645	3.11e-21	61	157	212	307	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P21171	3.40e-21	61	157	372	463	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001468_01157.