CAZyme Information: MGYG000001465_01177

Basic Information

• Species: Providencia alcalifaciens_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia alcalifaciens_A
• CAZyme ID: MGYG000001465_01177
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219	MGYG000001465_10|CGC2	24593.89	9.8525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001465	4108375	Isolate	not provided	not provided

• Gene Location: Start: 93468; End: 94127 Strand: -

Full Sequence      

MKKMVGSALVLLLLAGCSSDPNKTANRTRMLDNRNQMPNTTANTSYPRTPYDEFIRESAN
RYSVDETLIRAIIEVESNFRPEVVSKSNAIGLMQIKASTAGRDAYRYQGRSGEPSSNDLK
DPRKNIDIGTTYIRILKEQHLAGISHPQTMYYATVVAYVNGAGALLRTFDNDKTKAIAMI
NNLSPEEFYQHVQSKHPAPQAPRYLWKVKNAYNALAVNY

Enzyme Prediction     

No EC number prediction in MGYG000001465_01177.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	61	215	1e-21	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	1.03e-79	53	213	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	1.34e-75	8	215	7	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	3.38e-63	51	211	192	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	6.53e-28	55	178	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.35e-27	49	211	137	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLR06288.1	1.98e-155	1	219	1	219
SQI34553.1	3.16e-152	1	219	1	219
QLQ98847.1	3.16e-152	1	219	1	219
ATG17750.1	3.16e-152	1	219	1	219
VEB68984.1	4.64e-142	1	215	1	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	3.38e-58	62	215	33	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	4.48e-58	62	215	50	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	9.62e-58	62	215	33	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	9.62e-58	62	215	33	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	9.62e-58	62	215	33	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MKC3	1.15e-65	10	215	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
A8AFS5	2.48e-62	8	215	7	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
B5R2X1	4.63e-60	8	215	7	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=emtA PE=3 SV=1
B5BI54	4.63e-60	8	215	7	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain AKU_12601) OX=554290 GN=emtA PE=3 SV=1
Q5PN08	4.63e-60	8	215	7	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001465_01177.