CAZyme Information: MGYG000001461_04283

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_04283
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000001461_11|CGC2	41467.22	8.0424

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 64625; End: 65734 Strand: -

Full Sequence      

MRNKKNSLLHTLLFCFALPAAVQAQQPNLPWVDLSAQKERQIVISQGKADLYNGHPTTVL
LDDNRTILCTWSFGHGGKASFIAESKDGGLSWQNRRTPADWDTMNNCPSIYKLTDKQGKQ
RLFVFCADPLMGQSYSEDYGKTWSPVRSLNKPCVMAFSSIIQLKNGDYMGLYHRGNNDQD
RPPLTLWKSVSQDGGLTWSESVKVGEMEGRSPCEPCLFRTPDGKRLVCVARENDRVGNSL
MMFSDDEGASWTPLKETPWGLTGDRHVMKYTPDGRLIAVFRDMAPNSSTKGHFVAWVGHY
KDLREETSGQYKIKLLHSYAGSDCGYPGLEILPDGTIVAITYIKMKPGKEQHSIVEVRFK
LDETDAMLK

Enzyme Prediction     

No EC number prediction in MGYG000001461_04283.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.49e-30	85	359	52	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	8.17e-14	53	240	147	333	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	3.11e-12	66	337	2	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	1.03e-10	54	224	112	277	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.46e-09	158	294	17	176	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU73633.1	4.27e-109	29	369	204	546
QDV35524.1	2.32e-90	17	365	20	379
ALG49063.1	1.38e-60	28	369	198	568
AQW27075.1	1.03e-59	28	369	198	568
ATD48363.1	1.03e-59	28	369	198	568

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.999045	0.000171	0.000199	0.000164	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_04283.