CAZyme Information: MGYG000001461_02910

Basic Information

• Species: Bacteroides neonati
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides neonati
• CAZyme ID: MGYG000001461_02910
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644	MGYG000001461_5|CGC5	72876.29	5.4084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001461	5024706	Isolate	not provided	not provided

• Gene Location: Start: 298342; End: 300276 Strand: -

Full Sequence      

MKQIPSLLLCILLASLIMACGSKEKASNAVRYQFDHIIDIAYTPDTAVRCTGWFTDQGSW
MGFTLPQTDRWVNGFCGPFSIDKRNWMAKAAVTAHFGKAPKEVFTPDSTNYYPGELYLSA
RSASGKISQQLLFADATTALLSVYADTAGELCFTGNDWAPGTTFALDQTTVIATHPSGEI
VSIGFTPDTRITCTDTNYQAICEGGKKVSISLSFFYNEKEKVAGMQKAATVLCQPDSFIQ
ANNKRWEEYLSRILRKDMPKEYDRIAVKSVVTLLSNWRTNRGGLLHEGIIPSHAVGYFVG
FWAWDSWRFSVALARFAPELAKNNIRAMFDYQLPDGMIIDCIYTNPEENNARDSKPPLAA
WAVDEIFTHTQDTAFVREMYPQLLAYHRWWYLKRDHNRNGICEFGSTDGTTEAAAWESGM
DNAIRFDNAQMVKNDAENAWSFDQESVDLNAYLAQEYQLLKKFASLIGQPFEEKDYTADV
ANYFFDTETGFFFDRRLSDGSFVKEEGCEAYIPLWTGIATPEQMERAMKLLTDTTKFATY
IPFPTVAADNPKFMPKGYWRGPIWLDQTYFAIKGLRNYGYNDRADACTKQVFDRLQGLKN
GAPIHENYGTHTGECLKAPHFSWSSVHLLLLYEEYGKQANDITK

Enzyme Prediction     

No EC number prediction in MGYG000001461_02910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	202	635	1.6e-109	0.5421052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	3.98e-132	54	635	59	783	alpha-glucosidase; Provisional
COG3408	GDB1	8.61e-14	302	632	285	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	2.05e-12	296	580	123	444	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	1.45e-06	373	633	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PLN02567	PLN02567	4.91e-05	343	531	199	434	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR61716.1	0.0	7	637	9	644
AII67042.1	0.0	7	637	9	644
AII61903.1	0.0	7	637	9	644
QJR75045.1	0.0	7	637	9	644
ALA72871.1	0.0	7	637	9	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.58e-81	54	638	32	759	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	8.25e-81	54	638	32	759	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.15e-80	54	638	32	759	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	8.51e-78	231	638	248	760	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	3.69e-39	54	407	358	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.33e-80	54	638	55	782	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.83e-22	294	629	90	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	4.36e-22	294	629	90	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	9.18e-12	302	629	40	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1
O43280	3.04e-08	286	644	160	559	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001461_02910.