CAZyme Information: MGYG000001452_01482

Basic Information

• Species: Stoquefichus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Stoquefichus; Stoquefichus massiliensis
• CAZyme ID: MGYG000001452_01482
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		34943.2	6.6536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001452	3433076	Isolate	not provided	not provided

• Gene Location: Start: 349499; End: 350449 Strand: -

Full Sequence      

MKIRHMVILGCIFPVLFSLVLFFGVLMSAEDDDGGGGTSSTVTGMNLSPEVLKHHPMVEK
YAREYGIEDYVNYLLAIMQVESGGTTADVMQSSESLGLPPNSLDTESSIKQGCKYFSELL
TSAKGQGIEDINAVIQSYNYGGGYLGYVAGNGRKHSYTLAENFSRTHSGGVKVTYTNPIA
VARNGGWRYNYGNMFYTELVNQYLTVTHFDDKTVQAVMDEALKYQGWRYVYGGDNPNTSF
DCSGLVQWCYGKAGIRLPRVAQDQYDVTQHIPLSQAKAGDLVFFHSTYNSGSYVSHVGIY
VGNNRMYHAGDRARRS

Enzyme Prediction     

No EC number prediction in MGYG000001452_01482.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	2.16e-62	48	204	1	165	Lysozyme-like.
cd16891	CwlT-like	2.05e-59	54	204	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	8.98e-29	226	309	1	80	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	1.93e-26	212	313	73	174	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK13914	PRK13914	2.76e-26	213	311	365	458	invasion associated endopeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU01398.1	3.80e-183	1	311	1	311
QUO31087.1	2.19e-182	1	311	1	311
QIX10568.1	3.11e-182	1	311	1	311
BBK61250.1	3.11e-182	1	311	1	311
QHB22595.1	3.11e-182	1	311	1	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.52e-156	39	311	12	284	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	5.79e-134	44	311	19	288	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	2.82e-16	216	309	16	109	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
3I86_A	9.31e-13	233	313	42	118	Crystalstructure of the P60 Domain from M. avium subspecies paratuberculosis antigen MAP1204 [Mycobacterium avium subsp. paratuberculosis],3I86_B Crystal structure of the P60 Domain from M. avium subspecies paratuberculosis antigen MAP1204 [Mycobacterium avium subsp. paratuberculosis]
2K1G_A	2.11e-12	217	309	9	97	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	2.28e-67	45	311	51	305	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
O34636	1.23e-19	54	202	55	202	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
Q01836	7.10e-19	216	311	354	444	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
P21171	1.02e-18	217	311	372	461	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
P0DC90	6.79e-18	51	201	30	187	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.950896	0.045074	0.002357	0.000146	0.000109	0.001438

TMHMM  Annotations     

start	end
7	29