CAZyme Information: MGYG000001452_00042

Basic Information

• Species: Stoquefichus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Stoquefichus; Stoquefichus massiliensis
• CAZyme ID: MGYG000001452_00042
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000001452_1|CGC2	54953.33	5.3403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001452	3433076	Isolate	not provided	not provided

• Gene Location: Start: 43807; End: 45225 Strand: -

Full Sequence      

MKKDFLWGAALSNVQAEGGYLEDGKGLNVYDTLVVTPEKGIPPMFCDTAVATDHYHHYKE
DIDFMAEMGLKAYRFSVVWSRIHPLGDDEKPNEKGLAYYEDMVDYLLEKGIEPVVSLVHF
DMPDHLLRTYNGFLNKKVIDFYAKHVETVVNRLKGKVKYWLTYNEINLAPYQSDLVAGAY
CPDNMSKPELFVHLSINTAIAHARAVEVIKRVDPQAWVGGMIGHAPFYPLTCKSEDIIAA
DFKNKMHNYLPFDIMTSGQLPSYFLNYIQNRNINIKFDEKERQVILESSQKLDYLAFSYY
QSSVQSSFDDITDFIELEDAILFDQRGLKNPNYTANEWGWQIDGEGLRYSLVDLYQRYHK
PLFIVENGIGIDEKLVDGKVYDDERIQYYQKHIVSLKRAVEHDGVDLMGYLAWSPIDFLS
SHKEIRKRYGFVYINRDFDDLLDLKRYRKKSFYWYQKVIANNGEDLSDDIHY

Enzyme Prediction     

No EC number prediction in MGYG000001452_00042.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	463	9e-132	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	2.46e-159	1	467	4	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	2.49e-142	1	466	4	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.07e-131	1	466	6	477	6-phospho-beta-glucosidase BglA; Provisional
PRK09593	arb	1.01e-126	3	467	8	478	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	6.29e-123	3	467	6	474	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQV04539.1	3.59e-292	1	472	1	472
QQY27346.1	5.66e-289	1	472	1	472
QPS13834.1	8.04e-289	1	472	1	472
QMW75828.1	8.04e-289	1	472	1	472
QQV05702.1	9.36e-288	1	472	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	2.54e-130	1	466	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.97e-124	1	466	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	5.56e-124	1	466	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
6WGD_A	1.43e-121	5	466	12	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3PN8_A	6.43e-120	1	466	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	2.45e-130	1	466	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	1.39e-129	1	466	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	4.30e-123	5	466	12	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	6.26e-121	3	466	9	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	8.70e-116	5	468	8	464	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001452_00042.