CAZyme Information: MGYG000001451_00853

Basic Information

• Species: Paenibacillus_A antibioticophila
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A antibioticophila
• CAZyme ID: MGYG000001451_00853
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000001451_1|CGC13	36302.82	4.63

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001451	5573040	Isolate	not provided	not provided

• Gene Location: Start: 944412; End: 945392 Strand: +

Full Sequence      

MILVGASSFCHFRTIQGAVDFLEQTASGEQETICILPGIYEEQVIIYRSNLKMVGIGAVE
LTMNRYAKELDEDGNEIGTFATPTLFLGGERLVVENMTISNTAGMGEHIGQAVAVYAHCD
QTVFRNCVFKGHQDTLFTGPLPPKPKERAQFGGVPIREQHDHYRQLYQNCYIEGTVDFIF
GGATAYFDGCNIHSLLQAPGKRGYLTAASTPIGQQYGYVFCGCFITADPGVSEVFLGRPW
REYAQTVFVNCQMSEHIHPLGWDHWDNPANEQTVDYREYGPAEMMTAISKSRVAWARCEA
LEEAADNPAADYALEQVFAGTDFWRN

Enzyme Prediction     

No EC number prediction in MGYG000001451_00853.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	305	2.4e-81	0.9513888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	7.75e-57	12	280	94	373	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	5.90e-56	2	296	2	275	Pectinesterase.
PLN02773	PLN02773	3.42e-51	11	307	16	289	pectinesterase
PLN02432	PLN02432	6.78e-47	1	305	12	278	putative pectinesterase
PLN02708	PLN02708	1.44e-46	10	296	251	526	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO08110.1	7.20e-158	3	325	2	318
QPK54296.1	1.06e-157	3	325	2	318
QPK59387.1	1.06e-157	3	325	2	318
AIQ73518.1	1.13e-157	1	325	1	318
AIY07754.1	1.50e-157	3	325	2	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.33e-29	2	295	9	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	9.08e-27	12	280	19	263	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
2NSP_A	9.88e-27	12	317	18	333	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	1.25e-26	27	326	29	306	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	4.66e-26	12	280	19	263	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7Q7	1.24e-38	10	295	299	574	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9LVQ0	1.41e-38	5	297	13	280	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	1.52e-35	14	279	94	339	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9FF77	1.59e-35	2	295	308	583	Probable pectinesterase/pectinesterase inhibitor 47 OS=Arabidopsis thaliana OX=3702 GN=PME47 PE=2 SV=1
O48711	1.10e-34	2	279	238	495	Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana OX=3702 GN=PME12 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001451_00853.