CAZyme Information: MGYG000001451_00237

Basic Information

• Species: Paenibacillus_A antibioticophila
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A antibioticophila
• CAZyme ID: MGYG000001451_00237
• CAZy Family: GH65
• CAZyme Description: Alpha,alpha-trehalose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715	MGYG000001451_1|CGC7	81407.83	5.9209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001451	5573040	Isolate	not provided	not provided

• Gene Location: Start: 272562; End: 274709 Strand: +

Full Sequence      

MNMSLNTGIYASGQEPLYRHEWCIRETGHQEEDHQKNESLFALGNGYIGMRGNLEEGYHG
ASGSSVIGNYLNGFYDTEPIVYPEGAYGYPDQNHAMLNVPDAKAILLLVEGELFHLHTGM
VLKSERILDMQSGMLCRHVKWESPAGHQVRITTRRLVSLEHKHLAAVEYEVTALNFSGGL
SWISLMNPVAAGPEGSFDPRVGARRIEPSLLLEDSGFREDGLMYWMRHRTRRTRFALVTA
MSHSLEVPGGEAPVQYSDAGQLGIRLDFRLEAGQSGKLTKFIAYHTSRDYPEEELLKLSR
EMLESAGHGGFGSLAGEQRQALDYFWGKADIEIVGDPEMQQGVRFNAFGLLQSTGRDGMT
NIAAKGLTGEGYEGHYFWDTEMYTLPFFTYTLPEIGRKLLEFRYRTLDKARERAAVMSQR
GALYPWRTIAGEENSAYFPAGTAQVHINADICYGLQQYVLATGDETFLAEMGAEILFETS
RFWVDLGHYNPALGRAFCIDAVTGPDEYTAIVNNNAYTNLMVQEQLRFACRTAERLRSSY
PDHYERLKRKIGLLESEIADWKRAGESMYVPKDEGLGIYAQDDTFLLKKKWDFEGTPENN
YPLLLHYHPLVIYRHQVLKQADLVMALFLLGDRFTMEEKVRNYRYYEPLTTHDSSLSPCI
HSIVASEIGEAEEAYRYFRRTVRMDLDDVNKTRRTGCIRRQWLGHGWRWSKGSEE

Enzyme Prediction     

EC	2.4.1.64

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	344	696	6.4e-134	0.9301075268817204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	0.0	14	697	2	679	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
PRK13807	PRK13807	1.71e-163	21	697	9	668	maltose phosphorylase; Provisional
pfam03632	Glyco_hydro_65m	2.22e-132	344	697	1	361	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
pfam03636	Glyco_hydro_65N	4.12e-73	25	287	1	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK48442.1	0.0	21	696	17	690
QWU16788.1	0.0	15	696	10	690
AIQ38377.1	0.0	21	696	38	713
AIQ76999.1	0.0	21	696	17	692
AWV36280.1	0.0	21	696	17	692

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIQ_A	4.01e-92	17	707	3	683	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	7.26e-82	22	690	10	663	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTP_A	1.72e-67	22	691	14	659	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	3.28e-67	22	691	14	659	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
7FE3_A	2.41e-35	257	687	222	605	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L164	7.13e-224	14	696	6	687	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
Q8GRC3	2.71e-179	22	696	3	668	Alpha,alpha-trehalose phosphorylase OS=Geobacillus stearothermophilus OX=1422 GN=treP PE=1 SV=1
P9WN12	1.76e-154	22	696	12	667	Uncharacterized glycosyl hydrolase MT3509 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3509 PE=3 SV=1
P9WN13	1.76e-154	22	696	12	667	Uncharacterized glycosyl hydrolase Rv3401 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3401 PE=1 SV=1
Q49736	5.34e-148	22	696	12	667	Uncharacterized glycosyl hydrolase ML0392 OS=Mycobacterium leprae (strain TN) OX=272631 GN=ML0392 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.992184	0.007811	0.000027	0.000008	0.000004	0.000008

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001451_00237.