CAZyme Information: MGYG000001451_00008

Basic Information

• Species: Paenibacillus_A antibioticophila
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A antibioticophila
• CAZyme ID: MGYG000001451_00008
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	MGYG000001451_1|CGC1	50991.27	4.409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001451	5573040	Isolate	not provided	not provided

• Gene Location: Start: 6851; End: 8242 Strand: -

Full Sequence      

MMQKRKGKISILAILALLITLFAPLPFDAQATEAAIALDASENVTIAAYSAWDSNAVYLA
NDVVTYNGNDYRAKWWTQGDVPGETDVWELVPPSNGEYPVWSSSKAYVGNDIVSYNDQLY
KAKWWTLGEIPGIAAVWELISGNPNPNPNPGGPDDPPISGDFKVVGYYPSWEPDKIGTIQ
YQNLTHINYAFAIPTSDGSLLPLENPAAATQIIQTAHAKDVKVLLAVGGWSYNGTPLENT
FMAATSTPQKVTQFGDAIIAMAKQYGFDGVDMDWEHPRSDGSSKQQYESLMVYLSQELKK
ENMLLTSAVLSGVTPEGIIYWDAAAHTNAVINAVDWFNVMAYDGGDGDRHSTYDFAVLSA
KYWKETRNMPAEKVVLGVPFYGRPSWAPYRDILQANPNAYNTDISMINGMEAHYNGIPTI
ERKTQYALDNLGGVMIWELTQDTTNLDKSLLQAIGNKVRAQSN

Enzyme Prediction     

No EC number prediction in MGYG000001451_00008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	163	446	1.4e-53	0.9459459459459459
CBM5	49	88	3e-16	0.975
CBM5	98	137	9.7e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06545	GH18_3CO4_chitinase	1.41e-61	164	454	1	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
pfam00704	Glyco_hydro_18	1.18e-54	163	442	1	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	1.85e-49	163	442	1	334	Glyco_18 domain.
cd00598	GH18_chitinase-like	6.11e-40	164	442	1	210	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd06548	GH18_chitinase	8.25e-39	164	442	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU18460.1	7.36e-146	29	459	60	442
QRP38084.1	1.57e-142	29	459	60	442
ASN97117.1	1.57e-142	29	459	60	442
BCJ98260.1	1.35e-136	161	461	11	311
QNM13846.1	8.83e-135	49	458	78	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	1.03e-34	163	457	18	304	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
3CO4_A	1.97e-24	164	457	6	301	Crystalstructure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],3FND_A Crystal structure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
6TSB_AAA	3.75e-21	164	446	37	341	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	4.61e-21	164	446	56	360	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6KST_A	1.33e-20	160	386	5	261	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95M17	2.14e-19	162	382	22	268	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
Q9BZP6	7.27e-18	162	442	22	365	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
Q13231	1.69e-16	163	383	23	269	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q91XA9	1.74e-16	162	442	22	365	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
O35744	2.08e-16	158	442	18	365	Chitinase-like protein 3 OS=Mus musculus OX=10090 GN=Chil3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999053	0.000187	0.000188	0.000147	0.000138

TMHMM  Annotations     

start	end
7	29