CAZyme Information: MGYG000001447_01908

Basic Information

• Species: Prevotella oralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oralis
• CAZyme ID: MGYG000001447_01908
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	MGYG000001447_3|CGC3	71062.51	7.5291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001447	2849145	Isolate	not provided	not provided

• Gene Location: Start: 82495; End: 84378 Strand: +

Full Sequence      

MISKRLLIGTFVCLFCLLLSAQQRVKIVVKDAFVPDKVETLTGYVGEKITASYNHRILAQ
DIDKLVEPFANKVEDHLWQSEFWGKWMNSAVLAYRYKPSNQLLDNMRTAVDKLIATQDKN
GYIGNYAPEYHLHEWDIWGRKYCILGLLDYYGITKEKKALVAACREADFLMAELKAKNTS
IVSMGNHRGMAASSVLKPICYLYRYTGNKKYLDFALQIVREWETSDGPQLISKADIPVGK
RFPRPDYDNWYKWQQGQKAYEMMSCYEGLLELYRLTGNVTYLSAVEKTWQSIMDTEINIT
GSGSAMESWFGGKQVQYMPIKHYQETCVTATWIKLSRQLLMLTGNSKYADAIEQSLYNAL
LGAMKSDGSDWAKYTPLSGQRLQGSEQCGMGLNCCTASGPRGLFIIPQTAVMQSIKGAVI
NLYIPGTYTLQSPKGQEIIITQQGDYPQTGTVRIAFKVKQTEEFTLSLRIPEWSKDTKVT
LNGNDVVPAHNGSYLQINRKWSDGDHVELVLDMRAQLHFMGENPQYLAITRGPVVLTRDA
RLSGADVQAIITPDVDKNGNLDLIPVANRNPNIWMMFKACFYPESYKEEEPEPIEVELCD
YASAGNATSSFPFFKVWMPQLYNPRGN

Enzyme Prediction     

No EC number prediction in MGYG000001447_01908.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	29	536	7.7e-66	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.10e-68	54	536	17	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.34e-60	53	540	26	504	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam03663	Glyco_hydro_76	7.62e-05	200	295	164	254	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.08e-140	41	620	29	608
QHS51661.1	2.32e-38	85	535	123	578
ACM22580.1	1.22e-37	85	535	83	532
ACZ43114.1	1.40e-37	85	553	87	561
QSO49282.1	1.58e-36	85	551	77	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.76e-33	85	535	74	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	9.30e-32	28	553	29	576	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.32e-29	28	553	29	576	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	4.81e-27	99	565	158	632	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.090059	0.501009	0.407608	0.000368	0.000377	0.000544

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001447_01908.