CAZyme Information: MGYG000001445_01302

Basic Information

• Species: Cedecea davisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cedecea; Cedecea davisae
• CAZyme ID: MGYG000001445_01302
• CAZy Family: GH8
• CAZyme Description: Minor endoglucanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000001445_1|CGC18	38826.62	5.8645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001445	4852695	Isolate	not provided	not provided

• Gene Location: Start: 1386236; End: 1387246 Strand: -

Full Sequence      

MLMLFFSAQSIASQNVENWQSYKQRFIDQGRVIDSGNQQISHSEGQGYGMLLAEINGDRA
TFDSLWNWTHKNLYREDIGLFSWRYDPAKHQVNDRNDATDGDMLIGWALLRAGNRWNEKR
YIDASLGIQRALLSHAVINWAGKTVMLPGVEGFTHKDFINLNPSYFIFPAWRDFYSYSHR
AEWQKMIDDGLTLLDAMRFGEHRLPVDWVTVNKDGTVEPATDWPARFGFDAVRIPLYLNW
YQKDLPQNRIFSSFWEKQPEWNAPAWINVFTGTVAEYPLPGGMQAVRDFSVGSIREDYWD
KRYVGEDYYSSSLKLLTKAAAMEVNLTAHSGSTVVF

Enzyme Prediction     

No EC number prediction in MGYG000001445_01302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	17	318	5.5e-79	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	4.82e-89	15	316	4	314	Glycosyl hydrolases family 8.
COG3405	BcsZ	3.98e-58	2	247	11	260	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	2.90e-40	19	240	28	252	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX94391.1	2.40e-260	1	336	1	336
QGH31294.1	2.37e-170	6	323	25	341
QGH40276.1	2.37e-170	6	323	25	341
VDZ84614.1	2.14e-169	6	323	18	334
AIU71744.1	7.34e-147	19	323	28	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CZL_A	4.80e-102	19	316	32	329	ChainA, Glucanase [Raoultella ornithinolytica]
5GY3_A	2.67e-97	19	323	4	308	ChainA, Glucanase [Klebsiella pneumoniae]
6VC5_A	1.41e-69	17	326	6	318	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	7.06e-64	17	323	21	330	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]
3QXQ_A	4.29e-29	19	254	7	247	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27032	1.36e-112	1	320	12	329	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P18336	1.04e-92	19	292	27	302	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1
P37696	7.01e-66	17	323	29	338	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
Q8X5L9	5.69e-29	19	254	28	268	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	1.09e-28	19	254	28	268	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.728995	0.270171	0.000326	0.000254	0.000130	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001445_01302.