CAZyme Information: MGYG000001443_01782

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_01782
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269	MGYG000001443_1|CGC21	28257.95	5.9644

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2187445; End: 2188254 Strand: -

Full Sequence      

MFRDLHGRVRNTFQSHSRRVSRISLVIAAGGAGIAAPLLTAGSASAAPAPAHVQAHAPAA
QQVKSEQESGASSYTVEAGDTLYRIAVDHDVEGGWKGVYDANRQTVGGNPNLIHPGQRLT
LPTADDADKSADDSADKGAAEGGEAQSAPRTTAQQSGVVHPTRSDNLDGWINEALAVMKQ
HGIPGSYEGIHRNIIRESAGNPNAINNWDINAQNGTPSIGLLQVIQPTFDAYHVQGTAQD
LRDPVANIVAACNYAADRYGSIDNVNGPY

Enzyme Prediction     

No EC number prediction in MGYG000001443_01782.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13402	LT_TF-like	7.01e-30	192	268	6	81	lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG3953	SLT	6.60e-16	189	267	17	96	SLT domain protein [Mobilome: prophages, transposons].
pfam01464	SLT	1.45e-08	194	264	18	83	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00118	LysM	1.83e-07	73	121	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
NF033163	lipo_LipL71	2.69e-07	66	122	399	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID36106.1	8.39e-191	1	269	1	269
AXK34636.1	4.79e-103	1	269	1	274
QNP66800.1	5.89e-86	14	269	9	260
QMU16880.1	7.12e-82	17	269	12	292
ALC20241.1	7.12e-82	17	269	12	292

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54334	5.85e-14	166	267	1093	1191	Phage-like element PBSX protein XkdO OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdO PE=4 SV=2
P45931	1.18e-12	164	267	1343	1443	Uncharacterized protein YqbO OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.023335	0.950715	0.002231	0.022087	0.001308	0.000298

TMHMM  Annotations     

start	end
20	42