CAZyme Information: MGYG000001440_00150

Basic Information

• Species: Acidaminococcus intestini
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus intestini
• CAZyme ID: MGYG000001440_00150
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282		30346.62	5.3065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001440	2243900	Isolate	not provided	not provided

• Gene Location: Start: 148046; End: 148894 Strand: +

Full Sequence      

MDNNKQHTLKADVCCDGIGLHSGNPVAMTLKPAPADTGIVFIRTDLEGRPSVRAIASNIS
ATTRATTLTENGASVTTIEHVMAALAILAIDNCYIEMNSAEPPVGDGSAKGFMDPILRMG
LLEQDAPRHVYAIDHAFSCYDGDRYLVVLPYDGFRVTFTSINPHPLLGTQVLDVTDAGDT
LSQEIAPARTVAFEEEIAQLRKMGLGLGGTVENVVVFTKDGGTLSKVRFPDELIRHKILD
VIGDLYLLGPISAHVICMKSGHAFNDSVSRQIDAYRKANPAQ

Enzyme Prediction     

No EC number prediction in MGYG000001440_00150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	6	272	5.4e-90	0.988929889298893

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	4.07e-132	6	274	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	4.87e-117	5	276	3	280	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	1.48e-101	5	278	3	281	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13188	PRK13188	3.83e-96	3	279	2	305	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
TIGR00325	lpxC	6.60e-77	5	278	2	277	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEQ22979.1	1.07e-204	1	282	1	282
ADB48045.1	1.89e-148	1	282	1	281
QTV78319.1	1.80e-115	6	276	9	278
QNP78243.1	1.34e-106	6	276	2	271
BBG63219.1	2.17e-106	6	276	6	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U39_A	5.67e-65	5	278	5	282	Pseudomonasaeruginosa LpxC in complex with CHIR-090 [Pseudomonas aeruginosa PAO1]
4J3D_A	6.01e-65	5	278	3	280	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
5U3B_A	6.38e-65	5	278	3	280	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]
7K99_A	7.17e-65	5	278	3	280	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]
6MO4_A	7.17e-65	5	278	7	284	Co-Crystalstructure of P. aeruginosa LpxC-50067 complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6MKC0	7.50e-67	6	272	4	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=lpxC PE=3 SV=1
Q2S9Z8	3.00e-66	5	278	3	280	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Hahella chejuensis (strain KCTC 2396) OX=349521 GN=lpxC PE=3 SV=1
Q88N71	4.92e-65	5	274	3	276	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=lpxC PE=3 SV=1
A5W8P4	4.92e-65	5	274	3	276	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=lpxC PE=3 SV=1
B0KFS0	6.96e-65	5	274	3	276	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001440_00150.