CAZyme Information: MGYG000001436_03557

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_03557
• CAZy Family: GT1
• CAZyme Description: 4'-demethylrebeccamycin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000001436_2|CGC11	42496.64	7.3344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 721769; End: 722935 Strand: +

Full Sequence      

MAHLFIAVQRVLGHVIPALAIGQQLKKKGHKVTLVTHPANKELAVRAGLAFLPAEWGKFP
EKFIYEQAQEMDALLAGREVDWMICDSSQAAPAYAAEKRGIPWISLQTTVPYPEEALPGS
RTVFNRLRQSYARELNGVRMRLGLPPLTDDRRTRGDLAGLSPRLHLVNVHAALYPEEGGI
PEQSVFTGSCTLESGDRDRVTEASRLEAEPCPGRPVVLVCASSTERHDSREVMNRYIGAA
VSLSEENSFHLIVAEHKPYEGKRPLPPHVSWITAYPNHDLLLPRADAVITHGGCGTVQSV
MRYGVPMVVIPLASDQHLLARTCERLGIALTVGPEEAGRGRIGQALHSLLAEGNPYTPRA
KELAAIMGRDNPNETAVRAIEQVLQNNS

Enzyme Prediction     

No EC number prediction in MGYG000001436_03557.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	49	383	7.8e-29	0.8089005235602095

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	2.86e-40	13	378	12	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	5.58e-32	1	387	2	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	7.13e-23	13	337	7	344	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
cd03785	GT28_MurG	1.62e-07	3	317	1	287	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00201	UDPGT	5.50e-07	259	332	312	388	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV17343.1	6.28e-271	1	388	1	388
QKS43694.1	1.23e-65	1	336	1	329
QKS43687.1	9.37e-40	13	350	12	338
ATB36182.1	8.97e-24	68	383	108	418
ADG97408.1	1.25e-22	13	334	12	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	8.41e-11	13	385	15	386	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	8.56e-11	13	385	15	386	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
3RSC_A	6.74e-09	2	352	21	381	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3IAA_A	6.76e-09	2	352	21	381	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora],3IAA_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora]
5DU2_A	9.05e-09	13	352	38	384	Structuralanalysis of EspG2 glycosyltransferase [Actinomadura verrucosospora],5DU2_B Structural analysis of EspG2 glycosyltransferase [Actinomadura verrucosospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KHE4	3.62e-14	13	352	14	390	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
Q6BN88	1.04e-13	13	385	1059	1470	Sterol 3-beta-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ATG26 PE=3 SV=2
Q6C8M8	4.21e-12	13	330	1006	1362	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
Q0UY53	3.08e-11	13	384	964	1370	Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=ATG26 PE=3 SV=1
A7KAK6	5.26e-11	13	386	799	1201	Sterol 3-beta-glucosyltransferase OS=Pichia angusta OX=870730 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001436_03557.