CAZyme Information: MGYG000001436_03477

Basic Information

• Species: Paenibacillus_F sp000411255
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_F; Paenibacillus_F sp000411255
• CAZyme ID: MGYG000001436_03477
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
938	MGYG000001436_2|CGC10	104123.23	5.1191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001436	6290841	Isolate	not provided	not provided

• Gene Location: Start: 629392; End: 632208 Strand: +

Full Sequence      

MTRVQYDRNSWIIDGRRVFILSAAVHYFRLPRAEWAEVLDKSKEAGCNCIETYVPWNWHE
EEEGQWDFSGDKDLGAFLDLCAERGLYVIVRPGPYICAEWDMGGLPYWLERKPDMQYRKF
HREFLHYVDLYWDRLVPVVLPRLLSNSGTVIMVQVENEFQALGKPDKAYMEYLRDGLIER
GIDVPLVTCYGAVDGAVEFRNFWSHAEEHARTLEERFADQPKGVLEFWIGWFEQWGGPRA
NQKTASQVERKTYELIREGFTAINYYMFFGGTNFGHWGGRTIGEHTFMTTSYDYDAALDE
YLRPTAKYKALKLVHDFVRWMEPLLTETTGSTAFIPLGKHSSAKKKSGPQGTILFIHNDD
TERLNGMLDLQKFGIGCPLPGDNDSMQARALQAAGRHDHAAPASGQAAKPISPLPYTVEA
GAILPVVCGVEIGRTGAGQPVTLEAMTGFTTGFDRGRGAVYHEAGQQSALVLSAAGLTGL
EADCPLPQRVRTDEEGRLVFTLFHGKRPQTITVRHAGEEIARITVTDRAAVEAEAASIPE
ARGTAPVLTDWQRADEEPDAEKEFAREAEGPLDFTSFGRFSGYLAYEAEVDSAEEALRTL
TLPRIEDPARVYVNGRYAGQTTEIGAAAFDIPLRQGANRLRILVQNMGRYNFTQTLAEPK
GLSAMPSLGGASADLTEGWQVDGAGRVHSLRALPEIEGRIGLYRTLHTGKEYDSGVIVGY
GLSRLRVNGRKVVPQLWNETAWNRGEAPYGVADIGELLREGCNELEFDAEGISHIPKMKL
YLYASASRISGWVTAGAADPLGAANWSALESEPESGPNAAAAPSQEAVPDRDRLPRWFKA
AFDWPEHSGDDSLKRTDSVHAEQAGEPDGAKLKITLDGLSKGILWVNGFCLGRYWQIGPQ
ESYKIPVSLLKKRNEVLFYDEEGCHPGGVRLELVGGPA

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	12	315	1.6e-109	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	3.69e-115	10	315	1	315	Glycosyl hydrolases family 35.
PLN03059	PLN03059	9.75e-58	4	362	30	384	beta-galactosidase; Provisional
COG1874	GanA	4.02e-33	4	315	1	346	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	2.99e-09	31	205	8	179	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCJ44360.1	3.02e-294	4	929	2	842
QGG57148.1	2.16e-196	2	931	15	915
QLC59949.1	4.14e-189	1	934	1	855
QEJ97065.1	7.21e-189	1	934	8	862
QKS44796.1	9.39e-189	6	931	15	905

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	8.60e-69	1	316	15	337	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	2.35e-66	1	337	1	351	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
3THC_A	4.07e-63	1	347	8	361	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	6.25e-63	1	347	32	385	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
7KDV_A	1.24e-62	3	314	17	337	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3UPY5	3.04e-69	10	337	53	388	Beta-galactosidase-1-like protein 2 OS=Mus musculus OX=10090 GN=Glb1l2 PE=1 SV=1
A2RSQ1	2.66e-68	13	312	58	362	Beta-galactosidase-1-like protein 3 OS=Mus musculus OX=10090 GN=Glb1l3 PE=1 SV=1
Q5XIL5	3.49e-68	13	312	58	362	Beta-galactosidase-1-like protein 3 OS=Rattus norvegicus OX=10116 GN=Glb1l3 PE=2 SV=1
Q8NCI6	5.44e-68	13	318	82	392	Beta-galactosidase-1-like protein 3 OS=Homo sapiens OX=9606 GN=GLB1L3 PE=2 SV=3
Q8IW92	1.89e-67	10	312	53	362	Beta-galactosidase-1-like protein 2 OS=Homo sapiens OX=9606 GN=GLB1L2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001436_03477.