CAZyme Information: MGYG000001434_02104

Basic Information

• Species: Butyricicoccus pullicaecorum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Butyricicoccus; Butyricicoccus pullicaecorum
• CAZyme ID: MGYG000001434_02104
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	MGYG000001434_2|CGC2	48871.58	9.2377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001434	3299523	Isolate	not provided	Europe

• Gene Location: Start: 219008; End: 220303 Strand: -

Full Sequence      

MAGPFGGIKVLQFIQGFNLLIFALFTVFYAYQLFYVVAALWHDRKRTPMPEAKKQHKFAA
IISARNERAVISELVRSIKMQNYPAELLDVFVVADNCTDDTAEVAERAGAIVFKRFNRTE
VGKGYALDYAFQRIEKEYASAGYEGYFIFDADNLLDRNYVAEMNKVFDSGYRVITSYRNS
KNFDSNWISAGSALWFLRESKFLNNSRMILGTNCAVSGTGFLVACDVLRARGGWKYHLLT
EDIQFSIDCACEGERVGYCSTAVLYDEQPVTFEQSWNQRLRWSKGFYQVFARYGRKLFGG
VVKRRSFSCYDMLMTVAPAMLLTLASVAVNAFLLVSALLSTPVAVGVVRVTLSSILSSFG
GFYLTLLFFGAVTVITEWKHINTTAARKVLYTFTFPLFIFTYIPIAIVALFRKIEWKPIA
HTISKSIEEFQ

Enzyme Prediction     

No EC number prediction in MGYG000001434_02104.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	57	283	2.6e-23	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	5.04e-84	61	245	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	4.48e-37	19	408	15	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.80e-31	61	242	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	1.08e-21	58	285	4	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	4.95e-16	30	289	1	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61275.1	1.42e-177	10	429	1	421
ACV55180.1	1.08e-167	11	429	9	427
QOS69441.1	2.16e-167	11	429	9	427
AYH41686.1	2.17e-167	22	431	2	412
BAK44311.1	4.06e-167	11	430	9	428

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.18e-13	53	315	46	309	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	1.44e-13	43	295	101	345	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q3MB01	5.68e-11	61	327	111	373	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
312	334
354	376
389	411