CAZyme Information: MGYG000001433_01926

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_01926
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1045	MGYG000001433_1|CGC48	116944.65	4.6015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2517710; End: 2520847 Strand: +

Full Sequence      

MEKKTKRIAFVLATMLCGWQMMLAQPVSPAPTPTRAANDVKAMFSDAYPEKFGKFQIDYD
DWNSDKFLTTKTIVTPFGAADEVLKIEGLSTGSLQHNAQIALGTCNLSDMEYLHMDVYSP
SENGIGEFSFYLVSGWSKTVSCNVWYNFDTKQEYDQWISIDIPMSTFKNGGLNLAEINVL
RIARGKQGAPGTIVYVDNVYAYGKAVEPESDVKIVANGNANLTTDVPLISAPTPKVAAAN
VFNFFSDHYGDGKFDYAQSDYGDQKTVKSLITINDTEDQVFKIDNIVNGSKANVSIGSPN
LSGVDMLHLDIFSPGNDQGIGEFDFALTDFGGNGNDAGIWLNITDKGWHGQWISIDIPLS
KWTGAANMIRFRRGGKGSTGKLLYVDNVYAYKSESDDPKPVPDPTTVPVLTKDKSDVISI
FCEQYEEPGYQDEFGIVSAGNWGQNAKQKDEFVEIVAGNQTLKLTSWDLFPFKVHKNSDV
MDLSQMDYLHLSIYQNGALDENNKPVSVCIWINDKDNKVAQAPLLEVKQGEWTSVSFGMD
YFKNKIDLSRVYVIRLKVGGYPTQDIYVDNIFGYKGDPIRPGQVTEPYVDECDQKIQDST
PGTLPPMEQAYLGVNLASASGGSNPGTFGHDYLYPKFEDLYYFKAKGIRLLRIPFRAPRL
QHEVGGELDYDAGNTSDIKALAAVVKEAERLGMWVMLDMHDYCERNIDGVLYEYGVAGRK
VWDSAKNTWGDWEAMDEVVLTKEHFADLWKKIATEFKDYTNIWGYDLMNEPKGININTLF
DNYQAAIHAIREVDTKAQIVIEGKNYANAAGWEGSSDILKDLVDPVNKIVYQAHTYFDKN
NTGTYKNSYDQEIGGNVEVYKQRIDPFIAWLEKNNKKGMLGEYGVPYNGHAQGDERYMDL
IDDVFAYLKEKQLTSTYWCGGSMYDAYTLTVQPAKDYCTEKSTMKVMEKYIKDFDTSIPS
SLVETNADGNAIVLYPNPVKDNLKITSESGIEQVIVFNMIGQKVSERNEKGTNIELNLEA
LGKGTYLVTVRLEDGNVVNRKIVKM

Enzyme Prediction     

No EC number prediction in MGYG000001433_01926.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	611	927	4.9e-67	0.9929078014184397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.82e-29	643	922	33	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	8.59e-14	638	921	77	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam18962	Por_Secre_tail	4.30e-13	974	1043	1	72	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
TIGR04183	Por_Secre_tail	3.24e-10	974	1044	1	71	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
NF033708	T9SS_Cterm_ChiA	8.59e-06	991	1043	1	54	T9SS sorting signal type C. The sorting signals of type IX secretion systems (T9SS) in the CFB bacteria are long, compared to other prokaryotic C-terminal sorting motif-containing signals, including LPXTG, PEP-CTERM, and GlyGly-TERM, and they seem to contain multiple motifs. A few T9SS substrates, including ChiA, have a variant form of T9SS sorting signal that may score poorly to both TIGR04183 (type A) and TIGR04131 (type B), depend on T9SS for secretion, but are released from the cell rather than left anchored to the cell surface.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63368.1	8.95e-151	30	1045	530	1467
QQY82914.1	1.97e-80	599	1044	13	420
AUS05313.1	3.41e-78	609	1028	32	418
QUT26200.1	2.00e-75	605	950	33	356
ALJ47659.1	2.00e-75	605	950	33	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LX4_A	2.18e-46	610	958	12	321	CrystalStructure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_B Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_C Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_D Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],6R2J_A Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_B Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_C Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_D Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501]
4EE9_A	1.08e-43	612	933	5	291	Crystalstructure of the RBcel1 endo-1,4-glucanase [uncultured bacterium],4M24_A Crystal structure of the endo-1,4-glucanase, RBcel1, in complex with cellobiose [uncultured bacterium]
7P6G_A	2.70e-43	612	933	5	291	ChainA, Endoglucanase [uncultured bacterium],7P6G_B Chain B, Endoglucanase [uncultured bacterium],7P6H_A Chain A, Endoglucanase [uncultured bacterium],7P6H_B Chain B, Endoglucanase [uncultured bacterium]
6ZZ3_A	3.57e-43	612	933	5	291	ChainA, Endoglucanase [uncultured bacterium],6ZZ3_B Chain B, Endoglucanase [uncultured bacterium],6ZZ3_C Chain C, Endoglucanase [uncultured bacterium],6ZZ3_D Chain D, Endoglucanase [uncultured bacterium]
7P6I_A	3.67e-43	612	933	5	291	ChainA, Endoglucanase [uncultured bacterium],7P6J_A Chain A, Endoglucanase [uncultured bacterium],7P6J_B Chain B, Endoglucanase [uncultured bacterium],7P6J_C Chain C, Endoglucanase [uncultured bacterium],7P6J_D Chain D, Endoglucanase [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1HFS8	4.44e-33	611	951	29	327	Endo-beta-1,4-glucanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglB PE=1 SV=1
P58599	7.81e-31	611	952	117	424	Endoglucanase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=egl PE=3 SV=1
P17974	8.07e-31	611	952	119	426	Endoglucanase OS=Ralstonia solanacearum OX=305 GN=egl PE=1 SV=2
O74706	2.39e-26	611	951	34	331	Endo-beta-1,4-glucanase B OS=Aspergillus niger OX=5061 GN=eglB PE=1 SV=1
A2QPC3	2.39e-26	611	951	34	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002607	0.974130	0.022483	0.000293	0.000242	0.000224

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_01926.