CAZyme Information: MGYG000001433_01876

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_01876
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804	MGYG000001433_1|CGC46	91161.45	7.0173

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 2430571; End: 2432985 Strand: +

Full Sequence      

MKHKLLLFVLLTASLPIFATGSIKERLSPNETLWFTYPARNWSEQALHIGNGYMGASFYG
DVEKERFDIAEKTFWTGGPYSVPDFNYGVVKGGKDKIAAIRRSITDRRFAEADSLSRLYM
VGDYTNYGYFSMVGNLFVDFGKKNQPVQNYLRGIDLSTSRGFVEYTQGDVRFNREYFCSY
PDKLMALHFTADQKGKISFSLSHSLVYQPEKVTEGKDELIFNGIIQGNGLGYTIRMKVLH
QGGSIKVGHQQITVEGADEATVFYTVDTEYSPVYPLYKGEKPRQTTEKIIKSAITKGYET
VKHTHISDYQTLYNRVKFTLSGDTASEKLPTDIRVKQLQQGFTDDASLKVLWFNLSRYLL
ISASRPGTLPSNLQGVWNTFEKAPWNGNFQSNINLQEMYWGCGPTQLPECEEAYLEWIEG
LVEPGRKTAGEYYGTKGWVSHSTGNIWGHTVPGDDILWGLYPSGAAWHCRHLWEHYAFGG
DKSYLETKGYPIMKEAAEFWLENMVEYQKHFIIAPSVSAEHGIEMKNGSPVDYSTANGEQ
TAGRIFTLPAYQDIEMVYDLYTHVIKASECLGIDSAFREKVTIARNKLLPLKIGRYGQLQ
EWIDDVDNPRDHHRHIAHLYALYPGNMISYSQTPALALAVKKSLEMRGKGKFGERWPHTG
GNWSMAWRTALWTRLYEGDQAIGTFNQMIKESGYENMMSNQSGNMQVDATMATSGLFAEM
LLQSQEGFIHLLPALPTEWPEGKIEGLMARNGYRVNMEWKYGKLMKAEIILPHKADKPMV
KVQGSYLPESDNRVVLIQATGINN

Enzyme Prediction     

No EC number prediction in MGYG000001433_01876.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	30	772	6.9e-226	0.9667590027700831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	2.89e-61	33	270	1	231	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
cd14771	TrHb2_Mt-trHbO-like_O	2.67e-05	451	504	22	88	Truncated hemoglobins, group 2 (O); Mycobacterium tuberculosis hemoglobin O like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). This group includes a Mycobacterium tuberculosis TrHb2, Mt-trHbO, encoded by the Mycobacterium tuberculosis glbO gene, which is expressed throughout the Mycobacterium growth phase. It also includes a TrHb2 from the thermophilic Thermobifida fusca ( Tf-trHb) which has a high thermostability and at the optimal growth temperature for Thermobifida fusca (between 55 and 60 degrees C ), it is capable of efficient O2 binding and release. Tf-trHb shares a relatively slow rate of oxygen binding with Mt-trHbO.
COG1554	ATH1	2.32e-04	424	509	384	479	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74335.1	0.0	1	804	1	804
BCI62991.1	0.0	2	794	7	795
QEK99247.1	6.11e-170	22	779	19	770
QEL85753.1	1.36e-166	32	776	48	759
AZQ64685.1	5.20e-166	16	769	290	1028

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	8.87e-141	35	770	7	743	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	6.11e-126	33	769	24	731	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	1.46e-117	33	769	43	747	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAD_A	2.33e-93	28	782	15	851	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]
2EAB_A	1.20e-92	28	782	15	851	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	6.60e-127	25	766	46	799	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	3.77e-99	31	759	21	756	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	5.75e-70	18	759	12	775	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	4.36e-55	27	787	12	722	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000464	0.998756	0.000248	0.000178	0.000169	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_01876.