CAZyme Information: MGYG000001433_01084

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_01084
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1438	MGYG000001433_1|CGC28	159482.45	4.4866

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 1389081; End: 1393397 Strand: +

Full Sequence      

MLFASIFAGNVHAQQPYGACWHPEDIKNWSPETDPDAKFNRSTVKYAKRFKEPELIKANQ
FQFYEGQVCNSTILYHTCSLCPAQGANNFTGYQPTYWQYMDKVVYWAGSASEGIIIPPPA
PSIDAAHMNGVKMLGQVFFPPSAFGGTQEWVRQMLTVENGKYIYAIKLYEIAKYMGFDGW
FINEETGGGSTSEWVAFVKEFNKIADENGDTQMEIQWYNASGYPNTSILNAHPNTSQFLE
YGSVGDYRSYASQLNCTEEEVMQKIYSGVQCVNSGLTGYGSAMRTVYKETEHVGSLDLFC
PEERVWKDNVKDILDTQNNCGEKAYAAIEKTFQNEETMWVNRAGDPTDVSERNSWPGFSG
CILERSVITSMPFVTSFSTGVGKHRFVNGEKMNTQDWYHSGVQSIMPTWRWWIENKGNLK
AKINWDDAYNFGTSIKISGTLTQGDHLTRLYKTMIPVENGGKFRLVYKTNTENSIEVKLG
TESKTDGAWITLGNPTITDQNGWKVAEYDLSALKGKTVYIIALNFKATSEVAAYEALLGE
LAMLPANYAPVAPTVTNLNTTSVLGEEKGDIRLTWDFTTNEDFEHFDIYTELADGSKKLV
GQTRGEAFYIPTFERNGNDAYVNIAVVPVLKDMSEGAANKLKVEYPKATAPKISFKLSKS
YAVVGEEVTITAKGTGNPSAYEWVLPSSLQLTAGNLTDATITVKCLAAGKQKVTVKATNV
IGTSETTSEVVDVMEEAEIGEVKNVALKKTILDFSGSTNNNETPKNIIDGVTRPGSTSQK
WCNISSDHWTVIDLEGAYRIYGFKIYDCNSGPETGQNINSYRIYVSNDAKNWELLVDETG
REKDDVKSDFIAPVKARYIKLNPYSESGMTIRIWEFEVYGKDDNNMTVELPATMNINAGE
TATLVVNYNLNGDERAEQFTCTAIPSNAFVTIGEITEDTEKGVFNIPVTGANAIGGSQIK
VTVNNGGAYKERTVTVTIDSEKAPNILSGMTAQLRQYKSDYSFEAEYDEYTTVDLTDGNT
GKEGLMVIENPSSHKDDFWAIFEATETWKLSKIKVYIPNNNQGENDNGNKGSVNNEISFR
ISNDAKSWTTLKTFSDLQEVSELEYILPEYKECKYLAIVCNLNVYFYPSLAEVEAYEQLA
EAIPVMAPVAIKSGFNADVVAEAKPAVDHSTMVLDDQGWVLYNEDIQKEGSLPNDGILTS
NSGIKYQLADYTALNAVTLKTTNSPITLEFVSAQQAEELYLLSISANGTSKLEVTVNYED
ESTDVQTFSIGDWWSASSGQGEAYYGLSRIITKKNGWDFNADDIDERFEFRLFEQTVTAD
PSKKIVSITLNSKQSGSYPTVLAVSKKGKNESVGVEDTKLKESTVHVYPNPVAANETLYI
TTDDVQQVSLIALDGTVLIQQPVTKDITEIQMNNISSGMYLLITKGNNGLESVKVIVK

Enzyme Prediction     

No EC number prediction in MGYG000001433_01084.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	82	384	1.2e-52	0.9619047619047619
CBM32	756	877	1.7e-19	0.9032258064516129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	2.75e-92	13	543	26	549	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
pfam03644	Glyco_hydro_85	2.98e-55	85	382	1	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
cd06547	GH85_ENGase	6.38e-52	82	417	15	339	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
pfam00754	F5_F8_type_C	4.37e-13	755	863	5	112	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
TIGR04183	Por_Secre_tail	6.22e-09	1367	1438	1	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77959.1	0.0	1	1438	1	1438
QUB46808.1	0.0	11	1363	20	1377
EFC71182.2	0.0	13	1368	22	1382
EFC71183.2	0.0	1	1347	45	1397
QZT38518.1	3.25e-210	1	1097	10	1112

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHA_A	1.98e-82	16	624	6	599	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	1.98e-82	16	624	6	599	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	1.42e-81	16	624	11	604	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
2W91_A	3.55e-52	24	618	18	605	Structureof a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	7.61e-51	24	618	169	756	Crystalstructure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
F4JZC2	4.22e-15	84	612	82	621	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
Q9SRL4	1.61e-11	24	424	35	397	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
Q8BX80	6.51e-11	84	502	134	525	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
Q8NFI3	3.37e-10	84	479	142	511	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1
P0C7A1	3.87e-09	84	445	140	467	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.401867	0.594877	0.002248	0.000556	0.000222	0.000213

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_01084.