CAZyme Information: MGYG000001433_00980

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_00980
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575	MGYG000001433_1|CGC25	64136.06	6.0926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 1220519; End: 1222246 Strand: -

Full Sequence      

MKKKAVLVAYVALLATPVAVMAQYPQLTEEAKAKYDKMITEARRRSDEAWAKALPIIEKE
AEQGRPYIPWASRPDDLPQAKIPAFPGAEGGGMYSFGGRGGKVITVTNLNDRGPGSFREA
CETGGARIIVFNVSGIIRLESPIIVRAPYVTIAGQTAPGDGVCIAGESFWVDTHDVVVRH
MRFRRGETKVHHRDDSFGGNPIGNIMIDHCSCSWGLDENISFYRHMYDPGEGYNKEKLPT
VNVTIQNTISSQALDTYNHAFGSTLGGENCAFVRNLWASNAGRNPSVGWFGIFNFVNNVV
YNWVHRSVDGGDYRAMFNMVNNYYKPGPLTPRDTPVGHRILKPEAGRSKLDYKVYGRVYA
DGNIMEGYPEITKDNWNGGIQVEDQADTKGYTEQMRTNVPFVMPYINIMSATEAYDYVLA
NAGANIPRRDIVDERVIEEVKTGIPYYEKKLPKDAYGDRWGLAPKSQDTEGFFKYRRLPK
DSYKQGIITDIRQVGGYPEYKGTPYVDTDGDGMPDEWEVANGLNPNDPNDANEDCTGDGY
TNIEKYINGISTKNKVDWTDLKNNYDTLAGKGKLM

Enzyme Prediction     

No EC number prediction in MGYG000001433_00980.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	134	324	4e-66	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	1.37e-05	507	528	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77855.1	0.0	1	575	1	575
QUT92137.1	0.0	1	575	1	575
ALJ62113.1	0.0	1	575	1	575
QNL37620.1	0.0	1	575	1	579
QRQ56886.1	0.0	1	575	1	579

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XMA2	7.66e-51	84	550	23	414	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	1.06e-50	84	550	23	414	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B8NQQ7	1.02e-48	84	550	22	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
A1DPF0	1.45e-48	84	550	23	414	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q0CLG7	7.26e-48	84	550	22	413	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000337	0.998827	0.000202	0.000219	0.000202	0.000186

TMHMM  Annotations     

start	end
5	27