CAZyme Information: MGYG000001433_00973

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_00973
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
924	MGYG000001433_1|CGC25	101064.08	4.4503

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 1205155; End: 1207929 Strand: -

Full Sequence      

MKNRFTLFAMLLISTGILAQSPVKVDFDKDERALDEVHEPGYESWVITNCVDTTKVINGI
KITMANGKESDGASLKSHWHKVGIQAPYYARLVSDGLTVNGGDMYAEIDMTIEGLAPGSH
SLLTYHNTLDSPDDKTFGMIDVFVNGELKVEGLMQSNRVLSTYDAATAYVTFDVKENEPV
VVTFRSNEDSPSDASWNIVINGFCLDVPDAGKQAKSPFPADRDLHAEVENGNCTLKWTAA
QSAVLHDVYLGTDLNLVTNADKTSSCYKASQTNTTFDCTNLYSMNTYYWRVDEVEEDGTV
TKGEVWSFMPCQLAFPGAEGYGRYARGGRGGKVVYVTNLNDAGPGSFREAVTNGSGPRTV
LFAVSGIVRLESRIMSNEQITIAGQTAPGKGVCFRAAPIGINSESVCRFLRIRLGGGTTY
DGLGMAGTNHSIVDHCSVSWTIDEAFSSRGAKNLTLQRTLISEALNCAGHQNYPAGTEHG
YAGTISGQTGSFHHNLLAHCNGRNWSVGDAIDGSGTWVSKLDVFNNVVYNYGSRATDGEV
HKLNFVNNYYKKGAATTVGHILKLEIKGFGAGTEQAYYSGNIIEDKNGDLLNDGTDNQFG
RIYTLDSGSSEPTYEVFPDEPFFPSYATIHTAKDAYKSVLSDVGCNLPLLDEHDQRIVRE
TLEGSYTYVGSETGKKGLIDNEADAGGYENYPEITIDLDEFDTDRDGLPNWWEEMFGLNP
NSPEGDFSDSNDDDDRDGYTNLEEYLHWMATPHYEVKTGETVEIDLTKYTRGFEKNPVYT
VTKIDNGTATVDGNILKITPEESFGGIFYVDFTVTDAEGSACTRNIGVKVGDRAVGVEPV
SDTRQFAVNAYPNPVTDYLYVSTESTGDAKIQVMNAYGNSVLTETCNVSPNVACKLDVSF
LPMGIYFLKIQQEGLSETIKFIKK

Enzyme Prediction     

No EC number prediction in MGYG000001433_00973.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	365	550	5.2e-54	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18962	Por_Secre_tail	3.66e-11	851	922	2	71	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
TIGR04183	Por_Secre_tail	3.83e-10	850	924	1	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77843.1	0.0	1	924	1	924
QUT77858.1	0.0	1	924	1	936
BAV06696.1	4.17e-300	19	924	17	910
APA01008.1	6.73e-295	10	919	12	921
AXP80110.1	3.06e-291	16	919	20	913

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	7.03e-06	319	459	46	188	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	1.55e-41	308	754	16	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	3.86e-41	308	754	16	418	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q5B297	2.06e-39	313	754	21	415	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
A1DPF0	1.24e-38	313	754	22	419	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
B0XMA2	2.27e-38	313	754	22	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999129	0.000160	0.000154	0.000144	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_00973.