CAZyme Information: MGYG000001433_00965

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_00965
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403	MGYG000001433_1|CGC25	46217.48	6.2645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 1192029; End: 1193240 Strand: -

Full Sequence      

MTNMDKKMIKWIIPLLLIGGFISCTNGGKEEKETWSVKMARSEIQRFPEPWMIEKAKKPR
WGYTHGLVVKSMLELWKHTGDSTYYEYAKIYADSLIDESGRIRTMNYLSFNIDNVNPGKI
LFDFYERTRDSRYKIAMDTLRKQMAEQPRTREGGFWHKQRYPHQMWLDGIFMASPYLSQY
GTVFGDTTVFADVVNQITLIARKTYDPATGLYYHGWDESREQAWADKETGCSPNFWSRSI
GWYAAALVDVLDYLPGKTAGRDTILTLINGLAASLVKYQDPVTGVWYQVIDKGGSEGNYL
ESSATALFVYFFSKAIREGYISTDYKTMTDRAFNGMLKEFIKEEQDGSYTITNCCAVAGL
GGEPVYRDGSYEYYISEPVIENDPKSVGSFILAAIEYEKLNHK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	53	399	9.7e-124	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.70e-132	35	400	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.53e-107	39	400	19	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77835.1	8.18e-311	1	403	1	403
QJR67845.1	1.43e-225	4	400	1	397
QJR63583.1	1.43e-225	4	400	1	397
AND20254.1	1.43e-225	4	400	1	397
QUT83569.1	1.43e-225	4	400	1	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.11e-102	61	400	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.44e-96	60	400	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.01e-95	60	400	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	4.57e-15	149	366	183	386	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4Q88_A	1.28e-14	116	396	91	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.34e-95	60	400	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.49e-40	172	396	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.49e-40	172	396	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	6.25e-14	61	306	29	262	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000805	0.102712	0.896259	0.000069	0.000081	0.000071

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_00965.