CAZyme Information: MGYG000001433_00375

Basic Information

• Species: Bacteroides salyersiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides salyersiae
• CAZyme ID: MGYG000001433_00375
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724	MGYG000001433_1|CGC8	84271.65	7.2429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001433	5309986	Isolate	not provided	not provided

• Gene Location: Start: 453642; End: 455816 Strand: +

Full Sequence      

MMKRNICLVIVTLFLSLAAGAKEKDVVVMQSMVKRLIPAYAENFQFRKMKPIDGKDCFRL
DASDPRKIIISGNNANSMAMGLNHYLRYYCLTTISWYADIPVEMPETLPAVEKPIQIEAK
VDRRFFLNYCTYGYTMPFWQWKDWERLIDWMALNGINMPLAITGQEAVWYKVWKKIGLTD
EEIRSYFTGPTYLPWHRMANIDGWNGPLPMHWLDSQVELQKKILTRERELNMKPVLPAFA
GHVPGALKRIFPEANIQNLGKWAGFAEEYRCHFLNPEEALFATIQKQYIKEQTRLFGTDH
IYGVDPFNEVDPPSWEPKYLSKVSADMYHTLTAADPKAEWMQMTWMFYFDRKDWTAPRVK
AMLTGVPQGKMVLLDYHCENVELWKTTEHFHGQPYIWCYLGNFGGNTTLTGNVKESGARL
DNTLINGGSNFKGIGSTLEGLDVMQFPYEYIFEKAWTLNTDDRSWLNALADRHTGVTSEP
VREAWDILFNQVYVQVPRTLAILPNLRPVMNKPNNRTSINYPNTALLQAWQKLLQAPDCN
RDALRLDIITVGRQLLGNYFLTVKDDFDRMYEAKDLPALKARAAEMREILNDLERLNAFH
SRCSLDKWISDARKYGNTPELKNYYEKNARNLITTWGGRLNDYASRTWAGLIKDYYSKRW
DMYLDAVVAAVENNREFDQEKLDGEFRLFEDSWVSSTRPVEVTPEGDLLIYARFLLNKYE
RKIN

Enzyme Prediction     

No EC number prediction in MGYG000001433_00375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	66	715	5.7e-235	0.9909502262443439

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	124	457	1	332	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	4.45e-88	465	713	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.31e-27	29	109	3	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77134.1	0.0	1	724	1	724
QGT72320.1	0.0	1	723	1	726
QDH53244.1	0.0	1	723	1	726
QUT26058.1	0.0	1	723	1	726
QUT31320.1	0.0	1	723	1	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	4.10e-136	24	719	4	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	5.41e-83	14	646	159	803	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	6.14e-83	14	646	167	811	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	5.42e-82	14	646	182	826	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	2.31e-138	18	719	21	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	1.28e-129	30	719	50	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000439	0.998885	0.000181	0.000171	0.000150	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001433_00375.