CAZyme Information: MGYG000001430_02746

Basic Information

• Species: Holdemania massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemania; Holdemania massiliensis
• CAZyme ID: MGYG000001430_02746
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000001430_3|CGC3	56112.27	5.8237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001430	3757342	Isolate	not provided	Europe

• Gene Location: Start: 281131; End: 282579 Strand: +

Full Sequence      

MSHEFPKGFLWGGATSAAQVEGGFAEGGRGPSHLDYLQYRAPSQRQGRSLMQITEEEYWD
NKKHADQRNLAFRRGSDFVHHVEEDIRYFGEMGFKTYRMSISWSRLFPTGTESEPLAEGV
AFYHQVFQTCHRYGIEPLVTMIHYDIPAYLTETLNGWENPKVIDYFLRYARFLIDEYKQE
VKYWLTFNEINMICWSPYLGGGMFVEKSRRNRLSCIHQALHHQFIASALTVSYAHETAPG
LMMGNMTQRSQFYPLTCKPDDVLLTLKSDQFNLFFNDVMVFGEYPYFIKKYYADHDIHIN
PVENFEAILKAGTVDFISFSYYFTSVVNSELQEPVENFVKQQKNPYLKDSEWGWTIDPTG
LRIALNQLYDRYHKPCFVTENGLGARDEISPDGKIHDAYRIAYLRDHIRAMQEAIEDGVE
LLGYTIWGCLDLVSMSDIQMSKRYGMIYVDADDEGNGTYRRRKKDSFDWYKKVIASNGSD
LD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	478	5.4e-136	0.9953379953379954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	5	482	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	5	482	4	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	5	482	6	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	2.00e-169	5	481	4	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.96e-147	5	481	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM13367.1	1.01e-219	5	482	3	482
QTZ57784.1	4.55e-218	5	481	3	479
AGS46819.1	4.55e-218	5	481	3	479
BBK63065.1	1.25e-213	5	481	3	481
VTS96688.1	1.90e-212	5	481	3	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	5.15e-159	4	481	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	9.88e-143	5	481	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	8.96e-142	4	481	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.54e-141	4	481	6	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	2.92e-137	6	481	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.87e-161	5	481	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.26e-160	5	482	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	8.33e-151	5	482	7	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	1.49e-146	5	481	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	2.50e-145	1	481	1	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001430_02746.