CAZyme Information: MGYG000001429_01192

Basic Information

• Species: Alistipes_A ihumii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A ihumii
• CAZyme ID: MGYG000001429_01192
• CAZy Family: GH110
• CAZyme Description: Alpha-1,3-galactosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583		65003.33	5.4173

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001429	2772824	Isolate	not provided	not provided

• Gene Location: Start: 57133; End: 58884 Strand: -

Full Sequence      

MKTTFRALLAASLCLLTGCNVSTNGGDVYLSDFLDSASAESDAVPAIRAAVAYCAKTGAS
RLVLPGGELRLRPDRAEEKYQFISNNDESLKRIAFDLEGMRDFTIEGAGTKLLFSGFISP
FNLERCRNVTIRDLSIDYTRTFHSEGIVRAAGPGWLDVEFPGEYVCDLSDGCLRFLDDEG
TVYPFSSLLEFDAVKREPAFHVDDYWLAKHTIVARQQPGGLVRIFRDDLKAGIGNVMVFG
AARRLNPGFTISDSEGIAIRDVNLYHCGGMGVIAQRSRDIELHRLRVVPAPGKGRVISIT
ADATHFVNCGGYIRLLDCTFENQKDDATNIHGLYMPVDSITAPDRALLRWGHAGQYGVDF
LVPGMRVEVVDNMNLETYAHLTVESVNRINKNYTEVKFAEPLPERAGKSHLIAADEDYPE
VLVRGCRMSGNRARGLLLGSRGRIVIERNYFHIAGAAVLFEGDGNYWFEQSGVRDVSIRD
NVFENCNYGSLGWGNACIAVGSGIPERRQSRYHRNIRIENNVFRGFDPRIVNLYCVDGFV
FTDDNRIEHTDDYPYALGENRRFVTEYCDGVELPEERTADSIK

Enzyme Prediction     

No EC number prediction in MGYG000001429_01192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	28	574	5.2e-138	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14251	PL-6	0.002	429	523	216	311	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.
pfam13229	Beta_helix	0.002	420	553	10	140	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77296.1	2.57e-311	1	576	1	576
BBL12596.1	1.03e-307	1	578	1	578
BBL09802.1	1.03e-307	1	578	1	578
BBL01922.1	1.24e-306	1	578	1	578
QUR44558.1	7.57e-254	1	564	1	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JW4_A	9.73e-137	18	573	18	592	Crystalstructure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta],7JW4_B Crystal structure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta]
7JWF_A	5.46e-136	18	573	18	592	Crystalstructure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_B Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_C Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_D Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1KD83	3.50e-94	7	554	12	558	Alpha-1,3-galactosidase A OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=glaA PE=3 SV=1
Q89ZX0	2.48e-72	6	577	2	583	Alpha-1,3-galactosidase B OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=glaB PE=3 SV=1
Q64MU6	6.04e-67	28	583	26	591	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=glaA PE=3 SV=1
Q5L7M8	8.40e-67	28	583	26	591	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=glaA PE=3 SV=1
B2UNU8	3.91e-59	17	553	208	746	Alpha-1,3-galactosidase B OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=glaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000030	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001429_01192.