CAZyme Information: MGYG000001426_04031

Basic Information

• Species: Phytobacter massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter massiliensis
• CAZyme ID: MGYG000001426_04031
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883	MGYG000001426_5|CGC1	101237.29	8.3191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001426	4922332	Isolate	not provided	not provided

• Gene Location: Start: 64929; End: 67580 Strand: -

Full Sequence      

MPGRNPAFFVKLTMSKSHTAHPASTAIVKTLETGREKPFVSVVTPTWNRSAFLPWLLYMF
RYQDYPADRRELVILDDSPQSHLPVIERLTQGNPQAFNIRYIHHPERLALGRKRNMLNEL
AVGEYILCMDDDDYYPADKISWTIAMMQQHRALISGSDQIPIWYSHINRLFKTRSFGPQN
ILNGTFCYHRNYLRKHRYDDDCNLSEEAGFTNKFTANPLQLPGERTILCVSHSQNTFDKD
FVLGASEPLDTTLDQIVTDPLLRNWYLSLHNATHHRPVQWDIVDQAIIINLDKRPDRLSQ
IQQELLQLKFPAEKITRLAASEENDGRLGRRRSHLRALELAQQQGWRNYLLLEDDAVILK
QEKHINVLNRLLNGLAKLPWEVVILGGEVKQGTVLKSLNGMIHARDCQKVCAYLVNSAYY
ATLAQQMQRDPCDTPEGQWQPLLREGKWLACYPSLSYQRAGYSDIEHCITDNIGAYFNKI
TPKSAPLPETPVSGDETLCFYMETIENARFYSRIINALPAQEQKEILILTPWTHIKNYSE
TANPLCRHHLVLDSEKIPLAENMKKAKAALFNAIDNDIKHSREYLVQKTAYEKCWSVYLA
ILGNIMRTGILKNIKKIVMCSGNGLAEKPVSLFCKINNIDTDYIELANFPNKVFIDTQGS
NALSRLAADPAILQRLPAVDELFHRRWMVDYEREKRNPPLQALNNPCAGLINKASTAKIL
ASGKDYLFLPLQVSYDTQLWINADLRNEEAIKHACAAAKKSSIPLVVKIHPAETQLGEIK
QIVQLQQRYRFLISNENTLDLIKGASKVITINSTVGLEALLYKKPLEILGRCFYKNLSYE
EVKKYIHHYLFTGIETRAQEPVPTDIARQFLNHSAKLEEYWLS

Enzyme Prediction     

No EC number prediction in MGYG000001426_04031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	41	153	1.5e-17	0.6470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16438	beta_Kdo_transferase_KpsS_like	1.22e-28	617	834	1	204	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS like. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
cd16441	beta_Kdo_transferase_KpsS	2.00e-18	659	834	44	263	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
pfam00535	Glycos_transf_2	7.48e-15	41	202	1	156	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.62e-13	42	217	1	149	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam05159	Capsule_synth	5.59e-10	671	834	87	266	Capsule polysaccharide biosynthesis protein. This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS and LipB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMR46619.1	3.65e-285	14	534	1	528
QCA19732.1	8.36e-284	14	534	1	528
QMR52271.1	6.54e-278	14	520	1	514
AUV24995.1	9.26e-278	14	520	1	514
QKE21591.1	9.26e-278	14	520	1	514

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQ09	1.70e-23	38	249	3	218	Uncharacterized glycosyltransferase L193 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L193 PE=3 SV=1
P77414	9.02e-07	35	149	2	112	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001426_04031.