CAZyme Information: MGYG000001423_00184

Basic Information

• Species: Clostridium celatum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium celatum
• CAZyme ID: MGYG000001423_00184
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000001423_7|CGC1	44849.74	6.6566

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001423	3553421	Isolate	not provided	not provided

• Gene Location: Start: 7906; End: 9063 Strand: -

Full Sequence      

MLNYLRRVNYIRKQKIQKESMSAILSAVDFKKVENIAPNKIETIMFVLPGMMAYSGGHTS
VLRLGTSLVKKGYNVRYVSFVPQDLEEQKKNAEINLKEYKGEIIDHSKIFDVKNDIVIAT
SWDSVYYAKKASGYKMYFVQDYEPFFHMYGEMFLLAQKTYELGLHMVSLGQWNKYMIEKN
CEVDSSIDFITFPYEASEYYEIPRNYLEYKNKKEFTIAVYIKDTGKRAPYLLQHMIVSLK
EKLKSDGITLNVKYYGEKLDFKCEGGENLGKLSKSQLLELYQNSDFGMVASLTNISLVPY
EMLATGLPLIELEEGTFKYFFPEGCSILTSFDFNDLYEKIKYYIENPNKLKNMRDKSIAY
LDTLSWEKTANEFESILNKIIKEEA

Enzyme Prediction     

No EC number prediction in MGYG000001423_00184.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.61e-14	44	378	2	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.89e-08	41	384	17	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	1.15e-04	269	372	255	359	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
pfam13524	Glyco_trans_1_2	5.42e-04	295	347	12	64	Glycosyl transferases group 1.
cd03822	GT4_mannosyltransferase-like	8.92e-04	268	378	256	370	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLY79141.1	7.42e-157	15	382	18	387
AND83743.1	1.68e-141	3	382	4	383
ANP70838.1	2.84e-141	28	382	24	378
QNB67150.1	1.36e-140	3	382	4	383
QHQ63593.1	1.96e-135	16	381	14	379

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001423_00184.