CAZyme Information: MGYG000001422_04317

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_04317
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		45242.48	8.8649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 325610; End: 326800 Strand: +

Full Sequence      

MEECNAEQWHEKAGQLEIVVIIPTYNNGTTLATVIEDVLFYTENIIVVNDGSTDNTPVLL
ENYPNLRVITHPTNKGKGTALKNGLKQAKEAGYRYAITIDSDGQHFASDIPIFIKEIEKE
PDTLLVGARNLTSDNMPGKNTFANKFSNFWFKLETGIKLQDTQSGYRLYPLDKINVQRFY
YTAKYEFELEALVFAAWRGTTVRNIPIHVYYPPQEERISHFRPFRDFTRISILNTLLVFI
TFLWIYPRNFFRKLTWSNCRKFFHTHITHSNESNLKITYAIMLGVFMGIVPIWGYQMLAT
LFLAHLLKLNKVIAIVAANISIPPMIPFLLYGSYLTGCKALGRPIELHLTDISFENVKSV
LEQYLIGSVIFATACSILAGIIAISLLTIYRRSRTA

Enzyme Prediction     

No EC number prediction in MGYG000001422_04317.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	20	155	1.4e-26	0.8352941176470589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	2.06e-44	20	195	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
pfam00535	Glycos_transf_2	4.03e-24	20	169	2	159	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06442	DPM1_like	1.92e-23	20	207	1	197	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04187	DPM1_like_bac	4.49e-21	20	169	1	154	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.
COG0463	WcaA	1.17e-20	17	299	4	290	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61124.1	8.43e-264	1	395	1	395
QUT93345.1	3.43e-263	1	395	1	395
QUR44619.1	2.63e-221	2	394	3	395
QDM11511.1	4.34e-220	2	394	3	395
QUT78271.1	6.99e-220	2	394	16	408

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3VA58	5.95e-17	18	211	6	220	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminyltransferase OS=Methanococcus voltae OX=2188 GN=aglK PE=1 SV=1
A2E3C6	6.95e-14	15	207	73	286	Dolichyl-phosphate beta-glucosyltransferase ALG5D OS=Trichomonas vaginalis OX=5722 GN=ALG5D PE=1 SV=1
Q57964	3.67e-12	18	179	1	172	Uncharacterized protein MJ0544 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ0544 PE=4 SV=1
A2ELE6	6.66e-11	21	207	81	288	Dolichyl-phosphate beta-glucosyltransferase ALG5C OS=Trichomonas vaginalis OX=5722 GN=ALG5C PE=1 SV=1
D4GYG3	4.10e-10	18	226	7	211	Glycosyltransferase AglJ OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
230	247
277	299
312	334
365	387