CAZyme Information: MGYG000001422_02253

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_02253
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000001422_2|CGC15	89520.18	7.0495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 752116; End: 754449 Strand: +

Full Sequence      

MRAKICLVITSLLLVASSMNAQSIWDRAHLEKVKQSLHHPYFSAAYQELIADADKTLDVQ
PLSVMMKEKTPGSGDKHDYMSQARYYWPDPTQPDGLPYISRDGESNPELNKLDRNRLGAT
AQRVTTLALAWYFSGDEKYAQKATELIRVWFFNKDTRMNPNLEYAQMIPGHNNNKGRCYG
VIDTYSFVEMLDAVQLLEGSKAFTPKDAKQLKAWFGKLLTWILNSPQGQEEARQANNHST
AHDAQVIAFALYAGNMKVAQEVINAIPQKRIFTQIEPDGKQPHELRRTLAFGYSQFNLSH
LIDIFVMGRKIGISIDNATSADGRNFYKAMDFLVPYVGKEVEDWPYQQISEWDYKQQEFC
KDLYRTSLLNPARKDYLKIAKAHRVIDWKDRFNLLWVEADDVDNAYAFACGQLRFALACA
GKARKEADNQCKHRVVPRSINKDGSLKMVHPHDWCSGFFPGSLWQMYAYTNDDFWRQQAI
SNTWMIEEAKWHKGTHDLGFMMNNSFGKAYQLTGERSYKDVVLQSAKTLITRYSDKVKSI
RSWDHNRDKWKFPVIIDNLMNLEMLFWATQETGDSIYWKVAVNHANTTMKNHFRPDYSSY
HVVDYDPETGEVRAKQTAQGYADDSFWSRGQSWGLYGYTVCYRFTKDPAYLQQARHIADF
FLGLPNLPEDLIPYWDMKAPGIPDVPRDASAAAIMASALYELRNYVPAEDGKHYQDIADK
MVDSLNKHYRTEPETNYGFLLLHSTGHHPGGDEIDVPLNYADYYYLEALARKEALKQ

Enzyme Prediction     

No EC number prediction in MGYG000001422_02253.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	450	771	3.2e-132	0.9817629179331308
PL38	64	340	6.7e-110	0.985663082437276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	8.16e-94	63	342	1	273	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam07470	Glyco_hydro_88	1.02e-09	433	650	3	215	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89187.1	0.0	1	777	1	777
ALJ59781.1	0.0	1	777	1	777
QDO68113.1	0.0	1	777	1	777
QUU01289.1	0.0	1	775	1	784
QUT65853.1	0.0	1	775	1	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	5.81e-118	24	396	8	379	Crystalstructure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]
3WIW_A	2.40e-100	437	777	56	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	3.87e-53	437	771	51	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.97e-53	437	771	52	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.43e-52	437	771	52	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	7.73e-110	437	775	59	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	7.54e-59	437	771	50	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	5.49e-57	437	771	53	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	2.17e-52	437	771	52	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	1.23e-47	443	773	29	365	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.999061	0.000183	0.000161	0.000157	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_02253.