CAZyme Information: MGYG000001422_02092

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_02092
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1145	MGYG000001422_2|CGC9	131036.28	8.1899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 521563; End: 525000 Strand: -

Full Sequence      

MKGLKEVIIISLLLVWRCSAGMAQEYDINPPGVVIHNAPAITHEYVGSPSIVIMPDGTYI
ASHDYFGKKLSDTYVYISKDHGNTWERIAELKLLTWATLFNRGEELYLIGIKPRETIGYG
DFVVRKSLDYGRTWTDPKDEKSGLIRRGFYHCAPVPVVRHKGKYWRAMENMGQAWGWGPF
SALMTSISCKADLLDAAQWVFSNEIKYDSSWKEGATAWLEGNAVVTPKGEVKDILRVAYN
PDDLAAMVSVSADGRTMTFDPLTDFIRLPGASKKFTIRYDKKSRKYWTLSNFVLQKDRSG
ADNGGIRNTQVLMYSNDLKEWCIKDTLLTCGHPELYGFQYVDWQFDGEDIIFVSRTAWRD
KTGNPPRQHDANYLTFHRIHDFRALKRKPAIHSSYKSHIPDQLEPFRLSQVRLLPSPFKH
AQQLDAKWLLSLDPDRLLHRFHKNAGLPPKGENYGGWEEHRGGGRGLGHYMSACAMMWAS
TGEPEFKQRTDYVINELERCQKARGTGYIGSVEDSIWTQVGRGDIRSTGFDLNGGIVPWF
ILHKLFAGLYDIYIYTGNEKAKTVLVNLCDWAYRQFGNLNDEQWQKMLACEHGGMLEVLA
NVYSIVGDKKYLDMSHWFDHKQFFSPLSHQVDSLAGLHANTQIPKVVGLERRHQLTHSEE
DKVKSHFFWETVVKNHTYCIGGNGDGEHFGPKGILSNRLSDRTAETCNTYNMLKLTKMLL
AETGDTKYGDYYEKALYNHILASQNPETGMTTYYVPLVAGGKKGYSSAFETFTCCVGTGF
ENHARYGEAIYFKGRKNNLLVNLYIPSALTWEETGITIRQEGAYEKNGKVKFTINSSKPK
KASLFFRMPYWTTAKTEVKVNGRKIDNPVIPGMYLEITGEWKKNDIIEIHFDMPVYTEPT
PDNPNRLAIKYGPLVLAGKLGNKKIDPVKDIPVLIVDDKPVNEWVSRISQDSVLFRTQNI
GELSDITLAPFYTLYNERYIVYFDVFDTAGWEKRKQAYRNYLREQEELKKRTVDFIQLGE
MEPEREHNLRGKDTAVGELIGRKFRLSWNNGWFAFDMKVIDNTPLQLVSTYCGSDGESCS
FDIYVDGRLLKTITLKAQRSEELYDMKIDIPLEYTSEKDKVSVSFQSHKEKMIGRIFGVR
IVKTE

Enzyme Prediction     

No EC number prediction in MGYG000001422_02092.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	410	917	2.9e-200	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.04e-180	410	917	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.51e-127	401	976	7	575	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	6.11e-08	927	983	25	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
cd15482	Sialidase_non-viral	8.48e-05	45	142	144	245	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	0.006	49	138	202	297	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAU55151.1	6.78e-243	396	1143	40	788
QEM13389.1	8.92e-241	396	1145	30	780
QNA43676.1	7.22e-238	406	1145	44	783
QIX60435.1	1.45e-236	402	1143	46	789
ASU36278.1	6.37e-236	406	1143	14	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	7.37e-158	396	1069	18	732	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	6.15e-150	396	1059	18	722	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	8.92e-26	539	972	142	609	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	3.71e-17	470	915	106	605	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000589	0.469304	0.529602	0.000201	0.000160	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_02092.