CAZyme Information: MGYG000001422_01490

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_01490
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	MGYG000001422_1|CGC28	95328.42	5.6079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 1703133; End: 1705628 Strand: -

Full Sequence      

MKTKFSWIFYCLVSLLLSQSLSAAERFVVNEGSGFVWIQQGKSYPILIDLQEDKGVVRAV
TNLQTDAGKVTGITPEVIHSVAGNRMLIIGSMENSSWIKQLVKAGKINVADLQGKREKYI
LQTVKQPMEGVDEAVVIAGSDKRGTIYGIYELSQQMGVSPWYFWADVPVEKHDIISIKEG
IYTDGEPAVKYRGIFLNDEWPCLGNWAGDTFGGFNSKFYETVFELVLRLKGNFMWPAMWN
SAFYDDDPMNGPLADEMGIVMGTSHHEPMGQAQKDWKRRGTGEWNYTTNGAVLRDFWQQG
MERCKDWEAVITLAMRGDGDEPMSEDANISLLQNIVKDQRKIIEKVTGKKAKETPQVWAL
YKEVQDYYDKGMRVPDDVTLLLCDDNWGNVRKLPDLKAKPRKGGYGMYYHFDYVGAPRNT
KWINITQIQRTWEQMMLTYEYGVRELWVVNVGDLKPMEYPITFFLDMAWNPERFNENNLF
QHTVDFCKQQFGGNYAEEAARLIDTYTKYNRRVTPEMLNDRTYSLENYDEWQRVKDDYAA
LSLDALKFYYLMPADYRDTFDQLVLFPIQACANLYDMYYAVAMNRKLAEAGDVKTNKWAG
KVREYFERDSVLTYHYNHVMSSGKWNHIMDQTHIGYRSWNDPKHNIMPKVTLVPEARIAP
APPVFIEKDGYVSIEAEHYTRSVDCTSAKWITIPNLGRTLSAVTTSPCTATPEEDMYLEY
DFETEKSGEATVIVRFSSTLNFNDYKGLRYAVSLDGGEEQIVNINGDYKGELGRLQAEHI
ITTQTKHQCDKKAKHTLRIRPLDPALVIQKIMIDFGGLKPSFLGAPESSIK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	34	811	1.6e-286	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	185	517	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	7.99e-63	664	827	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.07e-05	72	152	49	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV05080.1	0.0	1	831	17	847
QDO71564.1	0.0	16	831	1	816
ALJ61511.1	0.0	1	831	1	831
QUT92919.1	0.0	1	831	1	831
QIU93956.1	0.0	8	831	4	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	8.61e-303	1	831	12	852	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	3.26e-281	35	831	17	837	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.35e-278	35	831	16	836	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	6.61e-221	46	828	25	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	2.27e-140	42	828	17	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999112	0.000179	0.000141	0.000133	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_01490.