CAZyme Information: MGYG000001422_01319

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_01319
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
939	MGYG000001422_1|CGC21	104366.67	5.3932

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 1458468; End: 1461287 Strand: +

Full Sequence      

MKRIITTCLLLSGTCLLSAQKIPSVYKPTKSEMYRKGWIDFNKNGVKDVYEDPNATLDAR
IEDLLSQMTLDEKTCQMVTLYGYKRVLKDDLPTPEWKQMLWKDGIGAIDEHLNGFQQWGL
PPSDNPNVWPASRHAWALNEVQRFFIEETRLGIPVDFTNEGIRGVESYRATNFPTQLGLG
HTWNRKLIHQVGLITGREARMLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAELGIE
MVRGMQHNHQVAATGKHFVAYSNNKGAREGMARVDPQMSPREVEMIHVYPFKRVIKEAGM
LGVMSSYNDYDGIPIQGSYYWLTKRLRGEMGFRGYVVSDSDAVEYLYTKHSTAKDMKEAV
RQSVEAGLNVRCTFRSPDSYVLPLRELVKEGGLSEDIINDRVRDILRVKFLIGLFDAPYQ
TDLAGADKEVEKAENEAVALQASRESLILLKNENNVLPLDINNIKTIAVCGPNANEEGYA
LTHYGPLAVEVITVLEGIRQKAEGKAEVLYAKGCDLVDANWPESELIEYPMTNEEQAEIN
KAVENARKADVAVVVLGGGQRTCGENKSRSSLDLPGRQLKLLQAVQATGKPVVLVLINGR
PLSINWADKFVPAILETWYPGSKGGTAVADVLFGDYNPGGKLTVTFPKSVGQIPFNFPCK
PSSQIDGGKNPGPDGNMSRVNGSLYPFGYGLSYTTFEYSNIEISPKMMTANQKATVRCKV
TNTGKRAGDEVVQLYIRDMLSSVTTYEKNLAGFERVHLQPGETKEVTFILDRKHLELLDK
HMEWVVEPGDFSIMVGASSEDIRLNGMLTVEDPDAPVQMQAKTDSPVTASTNLESVMNVL
DKKMNTIWEGNKGDYITFALENGSKVDGVSIAFNRSNGLPAEFEIQLSGGGGQFLTVYSG
TVSEYGKLISYTFKGTTASDLRIVLNDDRVGVAEVKIND

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	147	372	1.8e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	48	803	22	758	beta-glucosidase BglX.
PLN03080	PLN03080	2.09e-94	54	796	44	769	Probable beta-xylosidase; Provisional
COG1472	BglX	1.63e-75	134	516	41	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	6.20e-70	447	693	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.67e-62	69	408	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61698.1	0.0	1	939	1	942
QUT92742.1	0.0	1	939	1	942
QDO69526.1	0.0	1	935	1	938
QUT62569.1	0.0	1	936	1	941
QQA31118.1	0.0	1	936	1	941

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	6.24e-127	138	803	69	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.36e-126	138	803	69	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	7.95e-125	47	811	4	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	5.99e-124	47	811	4	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	4.40e-120	146	799	65	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	3.47e-145	150	800	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	1.48e-131	58	803	35	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	2.90e-131	58	803	35	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	2.58e-123	1	803	1	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	2.15e-96	54	802	32	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000883	0.996539	0.001916	0.000233	0.000215	0.000185

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_01319.